NARG1 Antibody - N-terminal region (ARP48989_P050)

• Product Number: ARP48989_P050
• Name: NARG1 Antibody - N-terminal region (ARP48989_P050)
• Protein Size (# AA): 866 amino acids
• Molecular Weight: 101kDa
• NCBI Gene Id: 80155
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: N(alpha)-acetyltransferase 15, NatA auxiliary subunit
• Alias Symbols: Ga19, NATH, TBDN, MRD50, NARG1, NAT1P, TBDN100
• Peptide Sequence: Synthetic peptide located within the following region: LRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSEL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
• Description of Target: The ARD1A-NARG1 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. NARG1 is required to control retinal neovascularization in adult ocular endothelial cells. In complex with G22P1 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBC; SUMO2; NAA50; DDI2; HYPK; VPS26A; NAA10; TSNAX; STAT1; VCAM1; ITGA4; FN1; ASUN; MATR3; SIRT7; RAD21; Naa15; XRCC5; XRCC6; UBA5; NAA11;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NAA15 (ARP48989_P050) antibody is Catalog # AAP48989 (Previous Catalog # AAPY02135)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NARG1
• Uniprot ID: Q9BXJ9
• Protein Name: N-alpha-acetyltransferase 15, NatA auxiliary subunit
• Protein Accession #: NP_476516
• Purification: Affinity Purified
• Nucleotide Accession #: NM_057175
• Tested Species Reactivity: Human
• Gene Symbol: NAA15
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human kidney
  
  WB Suggested Anti-NARG1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human kidney
• Image 2: Human Adult Placenta
  
  Host: Rabbit
  Target Name: NAA15
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Fetal Heart
  
  Host: Rabbit
  Target Name: NAA15
  Sample Type: Human Fetal Heart
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Fetal Lung
  
  Host: Rabbit
  Target Name: NAA15
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml