Catalog No: AVARP13049_T100
Price: $0.00
SKU
AVARP13049_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NAPA (AVARP13049_T100) antibody
Product Info
ReferenceLemons, P.P., et al., (1997) Blood 90 (4), 1490-1500.
Predicted Species ReactivityMouse, Cow, Dog, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human NAPA
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Mouse: 78%; Zebrafish: 78%
Peptide SequenceSynthetic peptide located within the following region: MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAAN
Concentration1.0 mg/ml
Blocking PeptideFor anti-NAPA (AVARP13049_T100) antibody is Catalog # AAP30724 (Previous Catalog # AAPP01381)
Gene SymbolNAPA
Gene Full NameN-ethylmaleimide-sensitive factor attachment protein, alpha
Alias SymbolsSNAPA
NCBI Gene Id8775
Protein NameAlpha-soluble NSF attachment protein
Description of TargetThe 'SNARE hypothesis' is a model explaining the process of docking and fusion of vesicles to their target membranes. According to this model, membrane proteins from the vesicle (v-SNAREs) and proteins from the target membrane (t-SNAREs) govern the specificity of vesicle targeting and docking through mutual recognition. Once the 2 classes of SNAREs bind to each other, they form a complex that recruits the general elements of the fusion apparatus, namely NSF (N-ethylmaleimide-sensitive factor) and SNAPs (soluble NSF-attachment proteins), to the site of membrane fusion, thereby forming the 20S fusion complex. Alpha- and gamma-SNAP are found in a wide range of tissues and act synergistically in intra-Golgi transport. The sequence of the predicted 295-amino acid human protein encoded by NAPA shares 37%, 60%, and 67% identity with the sequences of yeast, Drosophila, and squid alpha-SNAP, respectively.
Uniprot IDP54920
Protein Accession #NP_003818
Nucleotide Accession #NM_003827
Protein Size (# AA)295
Molecular Weight33kDa
Protein InteractionsUBC; RPA3; RPA2; RPA1; RNF2; ATP4A; STX5; ITGA4; FN1; VCAM1; VCP; DHX40; DHX29; THUMPD3; STAM2; VAMP2; APP; NSF; TRPC3; RTN4; STX12; GNA12; STX8; GOSR2; GOSR1; BNIP1; STX7; VAMP8; SNAP23; STX4; STX1A; SNAP25;
  1. What is the species homology for "NAPA Antibody - N-terminal region (AVARP13049_T100)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse, Cow, Dog, Zebrafish".

  2. How long will it take to receive "NAPA Antibody - N-terminal region (AVARP13049_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NAPA Antibody - N-terminal region (AVARP13049_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NAPA Antibody - N-terminal region (AVARP13049_T100)"?

    This target may also be called "SNAPA" in publications.

  5. What is the shipping cost for "NAPA Antibody - N-terminal region (AVARP13049_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NAPA Antibody - N-terminal region (AVARP13049_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NAPA Antibody - N-terminal region (AVARP13049_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NAPA Antibody - N-terminal region (AVARP13049_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NAPA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NAPA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NAPA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NAPA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NAPA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NAPA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NAPA Antibody - N-terminal region (AVARP13049_T100)
Your Rating