MYO5A Antibody - Middle region (ARP74082_P050)

Catalog No: ARP74082_P050

Host: Rabbit
Target Name: MYO5A
Sample Type: 721_B Whole Cell
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: MYO5A
Sample Tissue: Human PANC1 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the Middle region of Human MYO5A
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSRTEEPSEKKVPL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MYO5A (ARP74082_P050) antibody is Catalog # AAP74082

Target Info

• Gene Symbol: MYO5A
• Alias Symbols: GS1, MYO5, MYH12, MYR12
• NCBI Gene Id: 4644
• Description of Target: This gene is one of three myosin V heavy-chain genes, belonging to the myosin gene superfamily. Myosin V is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mRNA translocation. The protein encoded by this gene is abundant in melanocytes and nerve cells. Mutations in this gene cause Griscelli syndrome type-1 (GS1), Griscelli syndrome type-3 (GS3) and neuroectodermal melanolysosomal disease, or Elejalde disease. Multiple alternatively spliced transcript variants encoding different isoforms have been reported, but the full-length nature of some variants has not been determined.
• Uniprot ID: Q9Y4I1-2
• Protein Size (# AA): 1828
• Molecular Weight: 201 kDa