
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-MYC (AVARP04001_P050) antibody |
---|
Tested Species Reactivity | Human, Mouse |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Dog |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MYC |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: APKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-MYC (AVARP04001_P050) antibody is Catalog # AAP30255 (Previous Catalog # AAPP00425) |
Reference | Frater,J.L., et al., (2006) Cancer Genet. Cytogenet. 166 (2), 139-145 |
Gene Symbol | MYC |
---|---|
Gene Full Name | V-myc myelocytomatosis viral oncogene homolog (avian) |
Alias Symbols | MRTL, MYCC, c-Myc, bHLHe39 |
NCBI Gene Id | 4609 |
Protein Name | Myc proto-oncogene protein |
Description of Target | MYC is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this MYC gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene. |
Uniprot ID | P01106 |
Protein Accession # | NP_002458 |
Nucleotide Accession # | NM_002467 |
Protein Size (# AA) | 439 |
Molecular Weight | 49kDa |
Protein Interactions | UBC; USP37; USP22; KDM1A; SKP2; SMAD7; SNRNP70; CEP57; LDOC1; BRD3; KIDINS220; MAX; CSNK2B; CSNK2A1; USP28; NMI; PFDN5; TP73; EP400; SP1; PIAS2; ZBTB17; IGF2BP3; PTRF; SDK1; MRPL53; PRKCDBP; PHLDB2; KNDC1; MZT2B; RIN3; NEK11; MICALL2; NLRX1; NABP2; MYC; M |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "MYC Antibody - C-terminal region (AVARP04001_P050)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog".
-
How long will it take to receive "MYC Antibody - C-terminal region (AVARP04001_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "MYC Antibody - C-terminal region (AVARP04001_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "MYC Antibody - C-terminal region (AVARP04001_P050)"?
This target may also be called "MRTL, MYCC, c-Myc, bHLHe39" in publications.
-
What is the shipping cost for "MYC Antibody - C-terminal region (AVARP04001_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "MYC Antibody - C-terminal region (AVARP04001_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "MYC Antibody - C-terminal region (AVARP04001_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "49kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "MYC Antibody - C-terminal region (AVARP04001_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MYC"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MYC"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MYC"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MYC"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MYC"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MYC"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.