SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP37225_P050
Price: $0.00
SKU
ARP37225_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Mybbp1a (ARP37225_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse Mybbp1a
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 92%; Horse: 92%; Human: 86%; Mouse: 100%; Pig: 92%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: EKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-Mybbp1a (ARP37225_P050) antibody is Catalog # AAP37225 (Previous Catalog # AAPP09262)
Gene SymbolMybbp1a
Gene Full NameMYB binding protein (P160) 1a
Alias SymbolsP160, p67M, p160M, p67MBP, p160MBP, AL024407, AU019902
NCBI Gene Id18432
Protein NameMyb-binding protein 1A
Description of TargetMybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
Uniprot IDO35821
Protein Accession #NP_058056
Nucleotide Accession #NM_016776
Protein Size (# AA)1344
Molecular Weight152kDa
Protein InteractionsEed; DSK2; VPS9; NUB1; UBQLN1; SQSTM1; RAD23B; PSMD4; NBR1; L3mbtl2; Ppargc1a; Hdac1; Rnf2; Myod1; Hdac2; Dmrt2; Nanog; Smarca2; Nacc1; Smarca4; Nfe2; Pknox1;
  1. What is the species homology for "Mybbp1a Antibody - middle region (ARP37225_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig".

  2. How long will it take to receive "Mybbp1a Antibody - middle region (ARP37225_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Mybbp1a Antibody - middle region (ARP37225_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Mybbp1a Antibody - middle region (ARP37225_P050)"?

    This target may also be called "P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU019902" in publications.

  5. What is the shipping cost for "Mybbp1a Antibody - middle region (ARP37225_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Mybbp1a Antibody - middle region (ARP37225_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Mybbp1a Antibody - middle region (ARP37225_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "152kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Mybbp1a Antibody - middle region (ARP37225_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MYBBP1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MYBBP1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MYBBP1A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MYBBP1A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MYBBP1A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MYBBP1A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Mybbp1a Antibody - middle region (ARP37225_P050)
Your Rating
We found other products you might like!