Size:100 ul
$229.00
In Stock
SKU
ARP37224_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37224_T100-FITC Conjugated

ARP37224_T100-HRP Conjugated

ARP37224_T100-Biotin Conjugated

MYBBP1A Antibody - C-terminal region (ARP37224_T100)

Catalog#: ARP37224_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Guinea Pig, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133800 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse MYBBP1A
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Guinea Pig: 83%; Mouse: 100%; Rat: 92%
Complete computational species homology data Anti-MYBBP1A (ARP37224_T100)
Peptide Sequence Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MYBBP1A (ARP37224_T100) antibody is Catalog # AAP37224 (Previous Catalog # AAPS06807)
Datasheets/Manuals Printable datasheet for anti-MYBBP1A (ARP37224_T100) antibody
Target Reference Fan,M., (2004) Genes Dev. 18 (3), 278-289
Publications

Zheng, B. et al. Establishment of a proteomic profile associated with gonocyte and spermatogonial stem cell maturation and differentiation in neonatal mice. Proteomics 14, 274-85 (2014). IHC, WB, Guinea Pig, Mouse, Rat 24339256

Gene Symbol MYBBP1A
Official Gene Full Name MYB binding protein (P160) 1a
Alias Symbols P160, p67MBP, p160MBP, AL024407, AU019902
NCBI Gene Id 18432
Protein Name Myb-binding protein 1A
Description of Target Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
Swissprot Id Q7TPV4
Protein Accession # NP_058056
Nucleotide Accession # NM_016776
Protein Size (# AA) 1344
Molecular Weight 148kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MYBBP1A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MYBBP1A.
Protein Interactions Eed; DSK2; VPS9; NUB1; UBQLN1; SQSTM1; RAD23B; PSMD4; NBR1; L3mbtl2; Ppargc1a; Hdac1; Rnf2; Myod1; Hdac2; Dmrt2; Nanog; Smarca2; Nacc1; Smarca4; Nfe2; Pknox1;
  1. What is the species homology for "MYBBP1A Antibody - C-terminal region (ARP37224_T100)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Guinea Pig, Mouse, Rat".

  2. How long will it take to receive "MYBBP1A Antibody - C-terminal region (ARP37224_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MYBBP1A Antibody - C-terminal region (ARP37224_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MYBBP1A Antibody - C-terminal region (ARP37224_T100)"?

    This target may also be called "P160, p67MBP, p160MBP, AL024407, AU019902" in publications.

  5. What is the shipping cost for "MYBBP1A Antibody - C-terminal region (ARP37224_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MYBBP1A Antibody - C-terminal region (ARP37224_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MYBBP1A Antibody - C-terminal region (ARP37224_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "148kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MYBBP1A Antibody - C-terminal region (ARP37224_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MYBBP1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MYBBP1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MYBBP1A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MYBBP1A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MYBBP1A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MYBBP1A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MYBBP1A Antibody - C-terminal region (ARP37224_T100)
Your Rating
We found other products you might like!