Size:100 ul
$229.00
In stock
SKU
ARP37224_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37224_T100-FITC Conjugated

ARP37224_T100-HRP Conjugated

ARP37224_T100-Biotin Conjugated

MYBBP1A Antibody - C-terminal region (ARP37224_T100)

Catalog#: ARP37224_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityMouse
Predicted Species ReactivityGuinea Pig, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-133800 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of mouse MYBBP1A
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 83%; Mouse: 100%; Rat: 92%
Complete computational species homology dataAnti-MYBBP1A (ARP37224_T100)
Peptide SequenceSynthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MYBBP1A (ARP37224_T100) antibody is Catalog # AAP37224 (Previous Catalog # AAPS06807)
Datasheets/ManualsPrintable datasheet for anti-MYBBP1A (ARP37224_T100) antibody
Target ReferenceFan,M., (2004) Genes Dev. 18 (3), 278-289
Publications

Zheng, B. et al. Establishment of a proteomic profile associated with gonocyte and spermatogonial stem cell maturation and differentiation in neonatal mice. Proteomics 14, 274-85 (2014). IHC, WB, Guinea Pig, Mouse, Rat 24339256

Gene SymbolMYBBP1A
Official Gene Full NameMYB binding protein (P160) 1a
Alias SymbolsP160, p67MBP, p160MBP, AL024407, AU019902
NCBI Gene Id18432
Protein NameMyb-binding protein 1A
Description of TargetMybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
Swissprot IdQ7TPV4
Protein Accession #NP_058056
Nucleotide Accession #NM_016776
Protein Size (# AA)1344
Molecular Weight148kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MYBBP1A.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MYBBP1A.
Protein InteractionsEed; DSK2; VPS9; NUB1; UBQLN1; SQSTM1; RAD23B; PSMD4; NBR1; L3mbtl2; Ppargc1a; Hdac1; Rnf2; Myod1; Hdac2; Dmrt2; Nanog; Smarca2; Nacc1; Smarca4; Nfe2; Pknox1;
Write Your Own Review
You're reviewing:MYBBP1A Antibody - C-terminal region (ARP37224_T100)
Your Rating
Aviva ChIP Antibodies
Aviva Travel Grant
Aviva Tips and Tricks
Aviva Tissue Tool