Search Antibody, Protein, and ELISA Kit Solutions

MYBBP1A Antibody - C-terminal region (ARP37224_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37224_T100-FITC Conjugated

ARP37224_T100-HRP Conjugated

ARP37224_T100-Biotin Conjugated

Gene Symbol:
MYBBP1A
Official Gene Full Name:
MYB binding protein (P160) 1a
NCBI Gene Id:
18432
Protein Name:
Myb-binding protein 1A
Swissprot Id:
Q7TPV4
Protein Accession #:
NP_058056
Nucleotide Accession #:
NM_016776
Alias Symbols:
P160, p67MBP, p160MBP, AL024407, AU019902
Replacement Item:
This antibody may replace item sc-133800 from Santa Cruz Biotechnology.
Description of Target:
Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
Protein Size (# AA):
1344
Molecular Weight:
148kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MYBBP1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MYBBP1A.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of mouse MYBBP1A
Predicted Species Reactivity:
Guinea Pig, Mouse, Rat
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 83%; Mouse: 100%; Rat: 92%
Complete computational species homology data:
Anti-MYBBP1A (ARP37224_T100)
Peptide Sequence:
Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Eed; DSK2; VPS9; NUB1; UBQLN1; SQSTM1; RAD23B; PSMD4; NBR1; L3mbtl2; Ppargc1a; Hdac1; Rnf2; Myod1; Hdac2; Dmrt2; Nanog; Smarca2; Nacc1; Smarca4; Nfe2; Pknox1;
Blocking Peptide:
For anti-MYBBP1A (ARP37224_T100) antibody is Catalog # AAP37224 (Previous Catalog # AAPS06807)
Datasheets/Manuals:
Printable datasheet for anti-MYBBP1A (ARP37224_T100) antibody
Target Reference:
Fan,M., (2004) Genes Dev. 18 (3), 278-289
Publications:

Zheng, B. et al. Establishment of a proteomic profile associated with gonocyte and spermatogonial stem cell maturation and differentiation in neonatal mice. Proteomics 14, 274-85 (2014). IHC, WB, Guinea Pig, Mouse, Rat 24339256

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...