Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

MTUS1 Antibody - middle region (ARP44419_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44419_P050-FITC Conjugated

ARP44419_P050-HRP Conjugated

ARP44419_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Microtubule associated tumor suppressor 1
NCBI Gene Id:
Protein Name:
Microtubule-associated tumor suppressor 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ATIP, DKFZp586D1519, DKFZp686F20243, FLJ14295, KIAA1288, MP44, MTSG1, ATBP
Replacement Item:
This antibody may replace item sc-100293 from Santa Cruz Biotechnology.
Description of Target:
MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MTUS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MTUS1.
The immunogen is a synthetic peptide directed towards the middle region of human MTUS1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-MTUS1 (ARP44419_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; MMS19; ORC4; Ptpn6; MTUS1; AGTR2;
Blocking Peptide:
For anti-MTUS1 (ARP44419_P050) antibody is Catalog # AAP44419 (Previous Catalog # AAPP25729)
Printable datasheet for anti-MTUS1 (ARP44419_P050) antibody
Sample Type Confirmation:

MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HeLa, HepG2

Target Reference:
Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...