Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MTUS1 antibody - middle region (ARP44419_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP44419_P050-FITC Conjugated

ARP44419_P050-HRP Conjugated

ARP44419_P050-Biotin Conjugated

Gene Symbol:
MTUS1
NCBI Gene Id:
57509
Official Gene Full Name:
Microtubule associated tumor suppressor 1
Protein Name:
Microtubule-associated tumor suppressor 1
Swissprot Id:
Q9ULD2
Protein Accession #:
NP_001001924
Nucleotide Accession #:
NM_001001924
Alias Symbols:
ATIP, DKFZp586D1519, DKFZp686F20243, FLJ14295, KIAA1288, MP44, MTSG1, ATBP
Replacement Item:
This antibody may replace item sc-100293 from Santa Cruz Biotechnology.
Description of Target:
MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.
Protein Size (# AA):
1270
Molecular Weight:
141kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MTUS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MTUS1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MTUS1
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-MTUS1 (ARP44419_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; MMS19; ORC4; Ptpn6; MTUS1; AGTR2;
Blocking Peptide:
For anti-MTUS1 (ARP44419_P050) antibody is Catalog # AAP44419 (Previous Catalog # AAPP25729)
Datasheets/Manuals:
Printable datasheet for anti-MTUS1 (ARP44419_P050) antibody
Sample Type Confirmation:

MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HeLa, HepG2

Target Reference:
Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693

Tell us what you think about this item!

Write A Review
    Please, wait...