MTUS1 Antibody - middle region (ARP44419_P050)

Data Sheet
 
Product Number ARP44419_P050
Product Page www.avivasysbio.com/mtus1-antibody-middle-region-arp44419-p050.html
Name MTUS1 Antibody - middle region (ARP44419_P050)
Protein Size (# AA) 1270 amino acids
Molecular Weight 141kDa
NCBI Gene Id 57509
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Microtubule associated tumor suppressor 1
Description
Alias Symbols ATBP, ATIP, ICIS, MP44, ATIP3, MTSG1
Peptide Sequence Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693
Description of Target MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.
Protein Interactions UBC; MMS19; ORC4; Ptpn6; MTUS1; AGTR2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MTUS1 (ARP44419_P050) antibody
Blocking Peptide For anti-MTUS1 (ARP44419_P050) antibody is Catalog # AAP44419 (Previous Catalog # AAPP25729)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MTUS1
Uniprot ID Q9ULD2
Protein Name Microtubule-associated tumor suppressor 1
Publications

Negative regulation of EB1 turnover at microtubule plus ends by interaction with microtubule-associated protein ATIP3. Oncotarget. 6, 43557-70 (2015). 26498358

Sample Type Confirmation

MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HeLa, HepG2

Protein Accession # NP_001001924
Purification Affinity Purified
Nucleotide Accession # NM_001001924
Tested Species Reactivity Human
Gene Symbol MTUS1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Image 1
Human Pineal Tissue
Rabbit Anti-MTUS1 Antibody
Catalog Number: ARP44419_P050
Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
Observed Staining: Cytoplasmic and membrane in cell bodies of pinealocytes and their processes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Human MCF-7, HeLa, and human cancer
MTUS1 antibody - middle region (ARP44419_P050) validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.
Image 3
Human MCF-7, HeLa, and human cancer
MTUS1 antibody - middle region (ARP44419_P050) validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.
Image 4
Human Ovary Tumor
Host: Rabbit
Target Name: MTUS1
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com