Product Number |
ARP44419_P050 |
Product Page |
www.avivasysbio.com/mtus1-antibody-middle-region-arp44419-p050.html |
Name |
MTUS1 Antibody - middle region (ARP44419_P050) |
Protein Size (# AA) |
1270 amino acids |
Molecular Weight |
141kDa |
NCBI Gene Id |
57509 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Microtubule associated tumor suppressor 1 |
Description |
|
Alias Symbols |
ATBP, ATIP, ICIS, MP44, ATIP3, MTSG1 |
Peptide Sequence |
Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693 |
Description of Target |
MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. |
Protein Interactions |
UBC; MMS19; ORC4; Ptpn6; MTUS1; AGTR2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MTUS1 (ARP44419_P050) antibody |
Blocking Peptide |
For anti-MTUS1 (ARP44419_P050) antibody is Catalog # AAP44419 (Previous Catalog # AAPP25729) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MTUS1 |
Uniprot ID |
Q9ULD2 |
Protein Name |
Microtubule-associated tumor suppressor 1 |
Publications |
Negative regulation of EB1 turnover at microtubule plus ends by interaction with microtubule-associated protein ATIP3. Oncotarget. 6, 43557-70 (2015). 26498358 |
Sample Type Confirmation |
MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HeLa, HepG2 |
Protein Accession # |
NP_001001924 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001001924 |
Tested Species Reactivity |
Human |
Gene Symbol |
MTUS1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93% |
Image 1 | Human Pineal Tissue
| Rabbit Anti-MTUS1 Antibody Catalog Number: ARP44419_P050 Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic and membrane in cell bodies of pinealocytes and their processes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
|
|
Image 2 | Human MCF-7, HeLa, and human cancer
| MTUS1 antibody - middle region (ARP44419_P050) validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000. |
|
Image 3 | Human MCF-7, HeLa, and human cancer
| MTUS1 antibody - middle region (ARP44419_P050) validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000. |
|
Image 4 | Human Ovary Tumor
| Host: Rabbit Target Name: MTUS1 Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0ug/ml |
|