Size:100 ul
$289.00
In Stock
SKU
ARP57708_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP57708_P050 Unconjugated

ARP57708_P050-HRP Conjugated

ARP57708_P050-Biotin Conjugated

MRPS33 Antibody - middle region : FITC (ARP57708_P050-FITC)

Catalog#: ARP57708_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human RT33
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: KKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKP
Concentration 0.5 mg/ml
Blocking Peptide For anti-MRPS33 (ARP57708_P050-FITC) antibody is Catalog # AAP57708
Datasheets/Manuals Printable datasheet for anti-MRPS33 (ARP57708_P050-FITC) antibody
Gene Symbol MRPS33
Official Gene Full Name mitochondrial ribosomal protein S33
Alias Symbols S33mt, PTD003, CGI-139, MRP-S33
NCBI Gene Id 51650
Protein Name 28S ribosomal protein S33, mitochondrial
Description of Target Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. The 28S subunit of the mammalian mitoribosome may play a crucial and characteristic role in translation initiation. This gene encodes a 28S subunit protein that is one of the more highly conserved mitochondrial ribosomal proteins among mammals, Drosophila and C. elegans. Splice variants that differ in the 5' UTR have been found for this gene; all variants encode the same protein. Pseudogenes corresponding to this gene are found on chromosomes 1q, 4p, 4q, and 20q
Swissprot Id Q9Y291
Protein Accession # NP_444263
Protein Size (# AA) 106
Molecular Weight 11kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MRPS33.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MRPS33.
Protein Interactions UBC;
  1. What is the species homology for "MRPS33 Antibody - middle region : FITC (ARP57708_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "MRPS33 Antibody - middle region : FITC (ARP57708_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MRPS33 Antibody - middle region : FITC (ARP57708_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MRPS33 Antibody - middle region : FITC (ARP57708_P050-FITC)"?

    This target may also be called "S33mt, PTD003, CGI-139, MRP-S33" in publications.

  5. What is the shipping cost for "MRPS33 Antibody - middle region : FITC (ARP57708_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MRPS33 Antibody - middle region : FITC (ARP57708_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MRPS33 Antibody - middle region : FITC (ARP57708_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "11kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MRPS33 Antibody - middle region : FITC (ARP57708_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MRPS33"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MRPS33"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MRPS33"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MRPS33"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MRPS33"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MRPS33"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MRPS33 Antibody - middle region : FITC (ARP57708_P050-FITC)
Your Rating