| Product Number |
ARP57708_P050-FITC |
| Product Page |
www.avivasysbio.com/mrps33-antibody-middle-region-fitc-arp57708-p050-fitc.html |
| Name |
MRPS33 Antibody - middle region : FITC (ARP57708_P050-FITC) |
| Protein Size (# AA) |
106 amino acids |
| Molecular Weight |
11kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
51650 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
mitochondrial ribosomal protein S33 |
| Alias Symbols |
S33mt, PTD003, CGI-139, MRP-S33 |
| Peptide Sequence |
Synthetic peptide located within the following region: KKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. The 28S subunit of the mammalian mitoribosome may play a crucial and characteristic role in translation initiation. This gene encodes a 28S subunit protein that is one of the more highly conserved mitochondrial ribosomal proteins among mammals, Drosophila and C. elegans. Splice variants that differ in the 5' UTR have been found for this gene; all variants encode the same protein. Pseudogenes corresponding to this gene are found on chromosomes 1q, 4p, 4q, and 20q |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-MRPS33 (ARP57708_P050-FITC) antibody |
| Blocking Peptide |
For anti-MRPS33 (ARP57708_P050-FITC) antibody is Catalog # AAP57708 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human RT33 |
| Uniprot ID |
Q9Y291 |
| Protein Name |
28S ribosomal protein S33, mitochondrial |
| Protein Accession # |
NP_444263 |
| Purification |
Affinity purified |
| Gene Symbol |
MRPS33 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
