Search Antibody, Protein, and ELISA Kit Solutions

MMP13 Antibody - middle region (ARP56350_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP56350_P050-FITC Conjugated

ARP56350_P050-HRP Conjugated

ARP56350_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Horse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-101564 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human MMP13
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 83%
Complete computational species homology data:
Anti-MMP13 (ARP56350_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MMP13 (ARP56350_P050) antibody is Catalog # AAP56350 (Previous Catalog # AAPP38415)
Printable datasheet for anti-MMP13 (ARP56350_P050) antibody
Target Reference:
Borghese,B., (2008) Hum. Reprod. 23 (5), 1207-1213

Park, Y. S. et al. Controlled release of simvastatin from in situ forming hydrogel triggers bone formation in MC3T3-E1 cells. AAPS J. 15, 367-76 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast 23250670

Gene Symbol:
Official Gene Full Name:
Matrix metallopeptidase 13 (collagenase 3)
Alias Symbols:
NCBI Gene Id:
Protein Name:
Collagenase 3
Description of Target:
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MMP13.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MMP13.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...