Search Antibody, Protein, and ELISA Kit Solutions

MMP13 Antibody - middle region (ARP56350_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56350_P050-FITC Conjugated

ARP56350_P050-HRP Conjugated

ARP56350_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Horse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
MMP13
Official Gene Full Name:
Matrix metallopeptidase 13 (collagenase 3)
NCBI Gene Id:
4322
Protein Name:
Collagenase 3
Swissprot Id:
P45452
Protein Accession #:
NP_002418
Nucleotide Accession #:
NM_002427
Alias Symbols:
CLG3, MANDP1
Replacement Item:
This antibody may replace item sc-101564 from Santa Cruz Biotechnology.
Description of Target:
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art
Protein Size (# AA):
471
Molecular Weight:
42kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MMP13.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MMP13.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MMP13
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 83%
Complete computational species homology data:
Anti-MMP13 (ARP56350_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ADAMTS5; MMP14; BCAN; MMP13; F12; TIMP3; CCL7; COL2A1; LRP1;
Blocking Peptide:
For anti-MMP13 (ARP56350_P050) antibody is Catalog # AAP56350 (Previous Catalog # AAPP38415)
Datasheets/Manuals:
Printable datasheet for anti-MMP13 (ARP56350_P050) antibody
Target Reference:
Borghese,B., (2008) Hum. Reprod. 23 (5), 1207-1213
Publications:

Park, Y. S. et al. Controlled release of simvastatin from in situ forming hydrogel triggers bone formation in MC3T3-E1 cells. AAPS J. 15, 367-76 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast 23250670

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...