| Product Number |
ARP56350_P050 |
| Product Page |
www.avivasysbio.com/mmp13-antibody-middle-region-arp56350-p050.html |
| Name |
MMP13 Antibody - middle region (ARP56350_P050) |
| Protein Size (# AA) |
471 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
4322 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Matrix metallopeptidase 13 (collagenase 3) |
| Description |
|
| Alias Symbols |
CLG3, MDST, MANDP1, MMP-13 |
| Peptide Sequence |
Synthetic peptide located within the following region: HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Borghese,B., (2008) Hum. Reprod. 23 (5), 1207-1213 |
| Description of Target |
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art |
| Protein Interactions |
ADAMTS5; MMP14; BCAN; MMP13; F12; TIMP3; CCL7; COL2A1; LRP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MMP13 (ARP56350_P050) antibody |
| Blocking Peptide |
For anti-MMP13 (ARP56350_P050) antibody is Catalog # AAP56350 (Previous Catalog # AAPP38415) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MMP13 |
| Uniprot ID |
P45452 |
| Protein Name |
Collagenase 3 |
| Publications |
Clusterin secretion is attenuated by the proinflammatory cytokines interleukin-1β and tumor necrosis factor-α in models of cartilage degradation. J Orthop Res. (2020) 32725904
Intra-Articular Administration of Cramp into Mouse Knee Joint Exacerbates Experimental Osteoarthritis Progression. Int J Mol Sci. 22 (2021). 33810460
Park, Y. S. et al. Controlled release of simvastatin from in situ forming hydrogel triggers bone formation in MC3T3-E1 cells. AAPS J. 15, 367-76 (2013). 23250670 |
| Protein Accession # |
NP_002418 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002427 |
| Tested Species Reactivity |
Human, Horse |
| Gene Symbol |
MMP13 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 83% |
| Image 1 | Human Placenta
 | WB Suggested Anti-MMP13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta |
|
| Image 2 | Human
 | Sample Type: 1. Normal HUman Cartilage (50ug)2. Human Osteoarthritis cartilage (50ug)3. Human Osteoarthritis chondrocytes (50ug)4. Human Osteoarthritis chondrocytes +IL-1 (50ug)Primary Dilution: 1:2000Secondary Antibody: HRP conjugated anti-rabbitSecondary Dilution: 1:5000Image Submitted By: Mukundan AtturNYU Hospital for Joint Disease |
|
| Image 3 | Equine
 | Sample Type: Equine Cartilage Explants Primary Dilution: 1:1000 Secondary Antibody: Bio-Rad 170-5046 Secondary Dilution: 1:100,000Image Submitted By: Adam WilliamsUniversity of Nottingham |
|
