Search Antibody, Protein, and ELISA Kit Solutions

MAPK3 Antibody - middle region (ARP56432_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP56432_P050-FITC Conjugated

ARP56432_P050-HRP Conjugated

ARP56432_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-135900 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MAPK3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-MAPK3 (ARP56432_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MAPK3 (ARP56432_P050) antibody is Catalog # AAP56432 (Previous Catalog # AAPP38741)
Datasheets/Manuals:
Printable datasheet for anti-MAPK3 (ARP56432_P050) antibody
Target Reference:
Seomun,Y. (2008) Biochem. Biophys. Res. Commun. 372 (1), 221-225
Gene Symbol:
MAPK3
Official Gene Full Name:
Mitogen-activated protein kinase 3
Alias Symbols:
ERK1, HS44KDAP, HUMKER1A, MGC20180, P44ERK1, P44MAPK, PRKM3, ERT2, ERK-1, p44-ERK1, p44-MAPK
NCBI Gene Id:
5595
Protein Name:
Mitogen-activated protein kinase 3
Description of Target:
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, a
Swissprot Id:
P27361
Protein Accession #:
NP_002737
Nucleotide Accession #:
NM_002746
Protein Size (# AA):
379
Molecular Weight:
43kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAPK3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAPK3.
Protein Interactions:
MAPK1; DUSP4; STAR; RAF1; PTGDR; MAP2K1; NAB2; MYOG; DHPS; HDAC6; MAGED1; AMOT; FOXP2; CDC23; VPS52; L3MBTL3; TRIM54; DCP1A; UBC; TP53; PTGS2; RPS6KA2; MAPK3; PHF3; TEK; MBP; ELK1; CUEDC2; MAPKAPK2; GAB2; IRX2; ADAM15; VCP; ELK4; DAPK1; Rara; IQGAP1; TP53

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...