Catalog No: OPCA05151
Price: $0.00
SKU
OPCA05151
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for LUSH Recombinant Protein (Fruit fly) (OPCA05151) (OPCA05151) |
---|
Predicted Species Reactivity | Drosophila melanogaster |
---|---|
Product Format | Liquid or Lyophilized powder |
Reconstitution and Storage | -20°C or -80°C |
Purification | Affinity purified using IMAC |
Concentration | Varies by lot. See vial for exact concentration. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP |
Protein Sequence | MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 30-153 aa |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Reference | LUSH odorant-binding protein mediates chemosensory responses to alcohols in Drosophila melanogaster. Kim M.-S., Repp A., Smith D.P. Genetics 150:711-721(1998) |
Gene Symbol | lush |
---|---|
Gene Full Name | lush |
Alias Symbols | 76a;76c;76c(LUSH);CG8807;CG8807-PA;CG8807-PB;Dmel\CG8807;Dmel_CG8807;DmelOBP76a;lush;lush-PA;lush-PB;Obp76a. |
NCBI Gene Id | 40136 |
Protein Name | General odorant-binding protein lush |
Description of Target | Odorant-binding protein required for olfactory behavior and for activity of pheromone-sensitive neurons. Binds to alcohols and mediates avoidance behavior to high concentrations of alcohols, the alcohol-binding possibly resulting in activation of receptors on T2B neurons, the activation of these receptors inhibiting these neurons. Acts in concert with Snmp and lush to capture cVA molecules on the surface of Or67d expressing olfactory dendrites and facilitate their transfer to the odorant-receptor Orco complex. Required for cVA response, probably by binding to VA. May act by serving as an adapter that bridges the presence of gaseous pheromone molecules, cVA, to activation of specific neuronal receptors expressed on T1 olfactory neurons, possibly via a specific conformational change induced by cVA that in turn activates T1 receptors. T1 neurons are excited by the pheromone VA, while T2 neurons are inhibited by alcohols. Also binds to phthalates. |
Uniprot ID | O02372 |
Protein Accession # | NP_001163468 |
Nucleotide Accession # | NM_001169997 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 19.2 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review