LUSH Recombinant Protein (Fruit fly) (OPCA05151)

• Product Number: OPCA05151
• Name: LUSH Recombinant Protein (Fruit fly) (OPCA05151)
• Protein Size (# AA): Recombinant amino acids
• Molecular Weight: 19.2 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• NCBI Gene Id: 40136
• Purity: Greater than 90% as determined by SDS-PAGE.
• Concentration: Varies by lot. See vial for exact concentration.
• Source: E.coli
• Gene Full Name: lush
• Protein Range: 30-153 aa
• Alias Symbols: 76a;76c;76c(LUSH);CG8807;CG8807-PA;CG8807-PB;Dmel\CG8807;Dmel_CG8807;DmelOBP76a;lush;lush-PA;lush-PB;Obp76a.
• Peptide Sequence: MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
• Product Format: Liquid or Lyophilized powder
• Reference: LUSH odorant-binding protein mediates chemosensory responses to alcohols in Drosophila melanogaster. Kim M.-S., Repp A., Smith D.P. Genetics 150:711-721(1998)
• Description of Target: Odorant-binding protein required for olfactory behavior and for activity of pheromone-sensitive neurons. Binds to alcohols and mediates avoidance behavior to high concentrations of alcohols, the alcohol-binding possibly resulting in activation of receptors on T2B neurons, the activation of these receptors inhibiting these neurons. Acts in concert with Snmp and lush to capture cVA molecules on the surface of Or67d expressing olfactory dendrites and facilitate their transfer to the odorant-receptor Orco complex. Required for cVA response, probably by binding to VA. May act by serving as an adapter that bridges the presence of gaseous pheromone molecules, cVA, to activation of specific neuronal receptors expressed on T1 olfactory neurons, possibly via a specific conformational change induced by cVA that in turn activates T1 receptors. T1 neurons are excited by the pheromone VA, while T2 neurons are inhibited by alcohols. Also binds to phthalates.
• Reconstitution and Storage: -20°C or -80°C
• Protein Sequence: MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Uniprot ID: O02372
• Protein Name: General odorant-binding protein lush
• Protein Accession #: NP_001163468
• Purification: Affinity purified using IMAC
• Nucleotide Accession #: NM_001169997
• Gene Symbol: lush
• Predicted Species Reactivity: Drosophila melanogaster
• Image 1: LUSH Recombinant Protein (Fruit fly) (OPCA05151)