LACTB Antibody - C-terminal region (ARP52431_P050)

Catalog No: ARP52431_P050

WB Suggested Anti-LACTB Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LACTB
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LACTB (ARP52431_P050) antibody is Catalog # AAP52431 (Previous Catalog # AAPS30807)
• Reference: Hallis,T.M., (2007) J Biomol Screen 12 (5), 635-644

Target Info

• Gene Symbol: LACTB
• Gene Full Name: Lactamase, beta
• Alias Symbols: G24, MRPL56
• NCBI Gene Id: 114294
• Protein Name: Serine beta-lactamase-like protein LACTB, mitochondrial
• Description of Target: LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.This gene encodes a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). The encoded protein has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.
• Uniprot ID: P83111
• Protein Accession #: NP_116246
• Nucleotide Accession #: NM_032857
• Protein Size (# AA): 547
• Molecular Weight: 61kDa
• Protein Interactions: UBC; PAXIP1; SPRTN; ELAVL1; CALM1;