Catalog No: ARP52430_P050
Price: $0.00
SKU
ARP52430_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

LACTB Antibody - middle region (ARP52430_P050)

Datasheets/ManualsPrintable datasheet for anti-LACTB (ARP52430_P050) antibody
Product Info
ReferenceHallis,T.M., (2007) J Biomol Screen 12 (5), 635-644
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LACTB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE
Concentration0.5 mg/ml
Blocking PeptideFor anti-LACTB (ARP52430_P050) antibody is Catalog # AAP52430 (Previous Catalog # AAPS31805)
Gene SymbolLACTB
Gene Full NameLactamase, beta
Alias SymbolsG24, MRPL56
NCBI Gene Id114294
Protein NameSerine beta-lactamase-like protein LACTB, mitochondrial
Description of TargetLACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.This gene encodes a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). The encoded protein has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.This gene encodes a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). The encoded protein has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.
Uniprot IDP83111-2
Protein Accession #NP_741982
Nucleotide Accession #NM_171846
Protein Size (# AA)373
Molecular Weight41kDa
Protein InteractionsUBC; PAXIP1; SPRTN; ELAVL1; CALM1;
  1. What is the species homology for "LACTB Antibody - middle region (ARP52430_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "LACTB Antibody - middle region (ARP52430_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LACTB Antibody - middle region (ARP52430_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LACTB Antibody - middle region (ARP52430_P050)"?

    This target may also be called "G24, MRPL56" in publications.

  5. What is the shipping cost for "LACTB Antibody - middle region (ARP52430_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LACTB Antibody - middle region (ARP52430_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LACTB Antibody - middle region (ARP52430_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LACTB Antibody - middle region (ARP52430_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LACTB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LACTB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LACTB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LACTB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LACTB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LACTB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LACTB Antibody - middle region (ARP52430_P050)
Your Rating
We found other products you might like!