Search Antibody, Protein, and ELISA Kit Solutions

KDM1A Antibody - middle region (ARP80777_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
KDM1A
Official Gene Full Name:
lysine demethylase 1A
NCBI Gene Id:
23028
Protein Name:
Lysine-specific histone demethylase 1A
Swissprot Id:
O60341-2
Protein Accession #:
NP_001009999.1
Nucleotide Accession #:
NM_001009999.2
Alias Symbols:
AOF2, CPRF, KDM1, LSD1, BHC110
Description of Target:
This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
876
Molecular Weight:
96 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KDM1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KDM1A.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human KDM1A
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: EYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KDM1A (ARP80777_P050) antibody is Catalog # AAP80777
Datasheets/Manuals:
Printable datasheet for anti-KDM1A (ARP80777_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...