Search Antibody, Protein, and ELISA Kit Solutions

HTR1A antibody - N-terminal region (AVARP13041_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP13041_P050-FITC Conjugated

AVARP13041_P050-HRP Conjugated

AVARP13041_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
Protein Name:
5-hydroxytryptamine receptor 1A
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-10801 from Santa Cruz Biotechnology.
Description of Target:
This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HTR1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HTR1A.
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1A
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-HTR1A (AVARP13041_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HTR1A (AVARP13041_P050) antibody is Catalog # AAP30710
Printable datasheet for anti-HTR1A (AVARP13041_P050) antibody
Target Reference:
Czesak,M., (2006) J. Neurosci. 26 (6), 1864-1871

Szewczyk, B. et al. Gender-specific decrease in NUDR and 5-HT1A receptor proteins in the prefrontal cortex of subjects with major depressive disorder. Int. J. Neuropsychopharmacol. 12, 155-68 (2009). WB, IF, Human 18561871

Cordeaux, Y., Pasupathy, D., Bacon, J., Charnock-Jones, D. S. & Smith, G. C. S. Characterization of serotonin receptors in pregnant human myometrium. J. Pharmacol. Exp. Ther. 328, 682-91 (2009). WB, IF, Human 19075042

Iyo, A. H. et al. Differential regulation of the serotonin 1 A transcriptional modulators five prime repressor element under dual repression-1 and nuclear-deformed epidermal autoregulatory factor by chronic stress. Neuroscience 163, 1119-27 (2009). WB, IF, Human 19647046

Szewczyk, B. et al. Decreased expression of Freud-1/CC2D1A, a transcriptional repressor of the 5-HT1A receptor, in the prefrontal cortex of subjects with major depression. Int. J. Neuropsychopharmacol. 13, 1089-101 (2010). WB, IF, Human 20392296

Adeosun, S. O., Albert, P. R., Austin, M. C. & Iyo, A. H. 17β-estradiol-induced regulation of the novel 5-HT1A-related transcription factors NUDR and Freud-1 in SH SY5Y cells. Cell. Mol. Neurobiol. 32, 517-21 (2012). WB, IF, Human 22328058

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...