Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
AVARP13041_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP13041_P050-FITC Conjugated

AVARP13041_P050-HRP Conjugated

AVARP13041_P050-Biotin Conjugated

HTR1A Antibody - N-terminal region (AVARP13041_P050)

Catalog#: AVARP13041_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IF
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10801 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1A
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-HTR1A (AVARP13041_P050)
Peptide Sequence Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HTR1A (AVARP13041_P050) antibody is Catalog # AAP30710
Datasheets/Manuals Printable datasheet for anti-HTR1A (AVARP13041_P050) antibody
Target Reference Czesak,M., (2006) J. Neurosci. 26 (6), 1864-1871
Publications

Adeosun, S. O., Albert, P. R., Austin, M. C. & Iyo, A. H. 17b-estradiol-induced regulation of the novel 5-HT1A-related transcription factors NUDR and Freud-1 in SH SY5Y cells. Cell. Mol. Neurobiol. 32, 517-21 (2012). WB, IF, Human 22328058

Cordeaux, Y., Pasupathy, D., Bacon, J., Charnock-Jones, D. S. & Smith, G. C. S. Characterization of serotonin receptors in pregnant human myometrium. J. Pharmacol. Exp. Ther. 328, 682-91 (2009). WB, IF, Human 19075042

Iyo, A. H. et al. Differential regulation of the serotonin 1 A transcriptional modulators five prime repressor element under dual repression-1 and nuclear-deformed epidermal autoregulatory factor by chronic stress. Neuroscience 163, 1119-27 (2009). WB, IF, Human 19647046

Szewczyk, B. et al. Decreased expression of Freud-1/CC2D1A, a transcriptional repressor of the 5-HT1A receptor, in the prefrontal cortex of subjects with major depression. Int. J. Neuropsychopharmacol. 13, 1089-101 (2010). WB, IF, Human 20392296

Szewczyk, B. et al. Gender-specific decrease in NUDR and 5-HT1A receptor proteins in the prefrontal cortex of subjects with major depressive disorder. Int. J. Neuropsychopharmacol. 12, 155-68 (2009). WB, IF, Human 18561871

Gene Symbol HTR1A
Official Gene Full Name 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
Alias Symbols 5HT1a, 5-HT1A, ADRBRL1, ADRB2RL1
NCBI Gene Id 3350
Protein Name 5-hydroxytryptamine receptor 1A
Description of Target This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity.
Swissprot Id P08908
Protein Accession # NP_000515
Nucleotide Accession # NM_000524
Protein Size (# AA) 422
Molecular Weight 46kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HTR1A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HTR1A.
Protein Interactions UBC; RHOA; GABBR2; GPR26; S1PR1; S1PR3; HTR1D; HTR1B; GNAI3; HTR1A;
  1. What is the species homology for "HTR1A Antibody - N-terminal region (AVARP13041_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "HTR1A Antibody - N-terminal region (AVARP13041_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HTR1A Antibody - N-terminal region (AVARP13041_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HTR1A Antibody - N-terminal region (AVARP13041_P050)"?

    This target may also be called "5HT1a, 5-HT1A, ADRBRL1, ADRB2RL1" in publications.

  5. What is the shipping cost for "HTR1A Antibody - N-terminal region (AVARP13041_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HTR1A Antibody - N-terminal region (AVARP13041_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HTR1A Antibody - N-terminal region (AVARP13041_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HTR1A Antibody - N-terminal region (AVARP13041_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HTR1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HTR1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HTR1A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HTR1A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HTR1A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HTR1A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HTR1A Antibody - N-terminal region (AVARP13041_P050)
Your Rating
We found other products you might like!