Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
AVARP13041_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP13041_P050-FITC Conjugated

AVARP13041_P050-HRP Conjugated

AVARP13041_P050-Biotin Conjugated

HTR1A Antibody - N-terminal region (AVARP13041_P050)

Catalog#: AVARP13041_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IF
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-10801 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HTR1A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Complete computational species homology dataAnti-HTR1A (AVARP13041_P050)
Peptide SequenceSynthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-HTR1A (AVARP13041_P050) antibody is Catalog # AAP30710
Datasheets/ManualsPrintable datasheet for anti-HTR1A (AVARP13041_P050) antibody
Target ReferenceCzesak,M., (2006) J. Neurosci. 26 (6), 1864-1871
Publications

Adeosun, S. O., Albert, P. R., Austin, M. C. & Iyo, A. H. 17b-estradiol-induced regulation of the novel 5-HT1A-related transcription factors NUDR and Freud-1 in SH SY5Y cells. Cell. Mol. Neurobiol. 32, 517-21 (2012). WB, IF, Human 22328058

Cordeaux, Y., Pasupathy, D., Bacon, J., Charnock-Jones, D. S. & Smith, G. C. S. Characterization of serotonin receptors in pregnant human myometrium. J. Pharmacol. Exp. Ther. 328, 682-91 (2009). WB, IF, Human 19075042

Iyo, A. H. et al. Differential regulation of the serotonin 1 A transcriptional modulators five prime repressor element under dual repression-1 and nuclear-deformed epidermal autoregulatory factor by chronic stress. Neuroscience 163, 1119-27 (2009). WB, IF, Human 19647046

Szewczyk, B. et al. Decreased expression of Freud-1/CC2D1A, a transcriptional repressor of the 5-HT1A receptor, in the prefrontal cortex of subjects with major depression. Int. J. Neuropsychopharmacol. 13, 1089-101 (2010). WB, IF, Human 20392296

Szewczyk, B. et al. Gender-specific decrease in NUDR and 5-HT1A receptor proteins in the prefrontal cortex of subjects with major depressive disorder. Int. J. Neuropsychopharmacol. 12, 155-68 (2009). WB, IF, Human 18561871

Gene SymbolHTR1A
Official Gene Full Name5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
Alias Symbols5HT1a, 5-HT1A, ADRBRL1, ADRB2RL1
NCBI Gene Id3350
Protein Name5-hydroxytryptamine receptor 1A
Description of TargetThis is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity.
Swissprot IdP08908
Protein Accession #NP_000515
Nucleotide Accession #NM_000524
Protein Size (# AA)422
Molecular Weight46kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express HTR1A.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express HTR1A.
Protein InteractionsUBC; RHOA; GABBR2; GPR26; S1PR1; S1PR3; HTR1D; HTR1B; GNAI3; HTR1A;
Write Your Own Review
You're reviewing:HTR1A Antibody - N-terminal region (AVARP13041_P050)
Your Rating
Aviva Validation Data
Aviva HIS tag Deal
Aviva Pathways
Aviva Tips and Tricks