SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58844_P050
Price: $0.00
SKU
ARP58844_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Hsp90ab1 (ARP58844_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: NASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTK
Concentration0.5 mg/ml
Blocking PeptideFor anti-Hsp90ab1 (ARP58844_P050) antibody is Catalog # AAP58844
Gene SymbolHsp90ab1
Gene Full NameHeat shock protein 90 alpha (cytosolic), class B member 1
Alias SymbolsHsp, 90kDa, Hsp84, Hsp90, Hspcb, C81438, Hsp84-1, AL022974
NCBI Gene Id15516
Protein NameHeat shock protein HSP 90-beta
Description of TargetHsp90ab1 is a molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.
Uniprot IDP11499
Protein Accession #NP_032328
Nucleotide Accession #NM_008302
Protein Size (# AA)724
Molecular Weight83kDa
Protein InteractionsIsg15; Htt; HACE1; DNAJB2; Eed; Akt1; Hsp90ab1; Hsf1; Hdac6; UBQLN1; DSK2; Itgb1bp2; Mapk7; Pgr; Nr3c1; Vcp; CALM1; Stub1; Ptges3; Mks1; Iqcb1; Nphp4; Nphp1; Ahi1; Invs; CFTR; Nod2; Nr3c2; Nr1i3; Irf3; Ip6k2; PRKACB; Cdkn2a; Gcgr; Nod1; Chordc1; Slc34a1;
  1. What is the species homology for "Hsp90ab1 Antibody - N-terminal region (ARP58844_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "Hsp90ab1 Antibody - N-terminal region (ARP58844_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Hsp90ab1 Antibody - N-terminal region (ARP58844_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Hsp90ab1 Antibody - N-terminal region (ARP58844_P050)"?

    This target may also be called "Hsp, 90kDa, Hsp84, Hsp90, Hspcb, C81438, Hsp84-1, AL022974" in publications.

  5. What is the shipping cost for "Hsp90ab1 Antibody - N-terminal region (ARP58844_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Hsp90ab1 Antibody - N-terminal region (ARP58844_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Hsp90ab1 Antibody - N-terminal region (ARP58844_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "83kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Hsp90ab1 Antibody - N-terminal region (ARP58844_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HSP90AB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSP90AB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSP90AB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSP90AB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSP90AB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSP90AB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Hsp90ab1 Antibody - N-terminal region (ARP58844_P050)
Your Rating
We found other products you might like!