Search Antibody, Protein, and ELISA Kit Solutions

HOXC9 Antibody - middle region (ARP35813_T100)

100 ul

Regular Price: $249.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP35813_T100-FITC Conjugated

ARP35813_T100-HRP Conjugated

ARP35813_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-133673 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human HOXC9
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-HOXC9 (ARP35813_T100)
Peptide Sequence:
Synthetic peptide located within the following region: DRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYT
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HOXC9 (ARP35813_T100) antibody is Catalog # AAP35813 (Previous Catalog # AAPP23576)
Datasheets/Manuals:
Printable datasheet for anti-HOXC9 (ARP35813_T100) antibody
Target Reference:
Kosaki,K., (2002) Teratology 65 (2), 50-62
Publications:

Hur, H., Lee, J.-Y., Yun, H. J., Park, B. W. & Kim, M. H. Analysis of HOX Gene Expression Patterns in Human Breast Cancer. Mol. Biotechnol. 56, 64-71 (2014). IHC, WB, Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 23820980

Xuan, F; Huang, M; Liu, W; Ding, H; Yang, L; Cui, H; Homeobox C9 suppresses Beclin1-mediated autophagy in glioblastoma by directly inhibiting the transcription of death-associated protein kinase 1. 18, 819-29 (2016). IHC, WB, Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 26582930

Gene Symbol:
HOXC9
Official Gene Full Name:
Homeobox C9
Alias Symbols:
HOX3, HOX3B
NCBI Gene Id:
3225
Protein Name:
Homeobox protein Hox-C9
Description of Target:
HOXC9 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12.
Swissprot Id:
P31274
Protein Accession #:
NP_008828
Nucleotide Accession #:
NM_006897
Protein Size (# AA):
260
Molecular Weight:
29kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HOXC9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HOXC9.
Protein Interactions:
LPXN; ZNF384; CBX6; GTF2A1L; IRF9; NMI; PCGF2; ZFP36; POU2F1; POLR2D; HOXD9; HOXD1; HOXC13; ELAVL2; POLR3D; GMNN;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...