HOXC9 Antibody - middle region (ARP35813_T100)

• Product Number: ARP35813_T100
• Name: HOXC9 Antibody - middle region (ARP35813_T100)
• Protein Size (# AA): 260 amino acids
• Molecular Weight: 29kDa
• NCBI Gene Id: 3225
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Homeobox C9
• Alias Symbols: HOX3, HOX3B
• Peptide Sequence: Synthetic peptide located within the following region: DRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kosaki,K., (2002) Teratology 65 (2), 50-62
• Description of Target: HOXC9 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12.
• Protein Interactions: LPXN; ZNF384; CBX6; GTF2A1L; IRF9; NMI; PCGF2; ZFP36; POU2F1; POLR2D; HOXD9; HOXD1; HOXC13; ELAVL2; POLR3D; GMNN;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HOXC9 (ARP35813_T100) antibody is Catalog # AAP35813 (Previous Catalog # AAPP23576)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXC9
• Uniprot ID: P31274
• Protein Name: Homeobox protein Hox-C9
• Publications:

  Homeobox C9 suppresses Beclin1-mediated autophagy in glioblastoma by directly inhibiting the transcription of death-associated protein kinase 1. Neuro-oncology. 18, 819-29 (2016). 26582930

  Hur, H., Lee, J.-Y., Yun, H. J., Park, B. W. & Kim, M. H. Analysis of HOX Gene Expression Patterns in Human Breast Cancer. Mol. Biotechnol. 56, 64-71 (2014). 23820980

• Protein Accession #: NP_008828
• Purification: Protein A purified
• Nucleotide Accession #: NM_006897
• Tested Species Reactivity: Human
• Gene Symbol: HOXC9
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 93%; Rat: 100%; Sheep: 100%
• Image 1: Human Lung
  
  Human Lung
• Image 2: Transfected 293T
  
  WB Suggested Anti-HOXC9 Antibody Titration: 2.5ug/ml
  Positive Control: Transfected 293T
• Image 3: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: HOXC9
  Sample Tissue: Human Jurkat Whole Cell
  Antibody Dilution: 1ug/ml