- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for Histone H3 Antibody (Phospho-Thr11) (OAAF07471) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence |
Additional Information | Modification Sites: Human:T11 Mouse:T11 Rat:T12 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human Histone H3 around the phosphorylation site of Thr11. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALR |
Concentration | 1mg/ml |
Specificity | Histone H3 (Phospho-Thr11) Antibody detects endogenous levels of Histone H3 only when phosphorylated at Thr11. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | IF: 1:100~1:500 ELISA: 1:1000 |
Gene Symbol | H3-3A|H3-3B|H3C1|H3C10|H3C11|H3C12|H3C13|H3C14|H3C15|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8 |
---|---|
Gene Full Name | H3 clustered histone 1|H3 clustered histone 10|H3 clustered histone 11|H3 clustered histone 12|H3 clustered histone 13|H3 clustered histone 14 |
Alias Symbols | H3;H3 histone family member 3A;H3 histone family member 3B;H3 histone family, member A;H3 histone family, member B;H3 histone family, member C;H3 histone family, member D;H3 histone family, member F;H3 histone family, member H;H3 histone family, member I;H3 histone family, member J;H3 histone family, member K;H3 histone family, member L;H3 histone family, member M;H3 histone, family 2;H3 histone, family 3A;H3 histone, family 3B (H3.3B);H3.1;H3.2;H3.3A;H3.3B;H3.f;H3/A;H3/b;H3/c;H3/d;H3/f;H3/h;H3/i;H3/j;H3/k;H3/l;H3/M;H3/n;H3/o;H3-3A;H3-3B;H3C1;H3C10;H3C11;H3C12;H3C13;H3C14;H3C15;H3C2;H3C3;H3C4;H3C6;H3C7;H3C8;H3-clustered histone 13;H3-clustered histone 14;H3-clustered histone 15;H3F1K;H3F2;H3F3;H3F3A;H3F3B;H3FA;H3FB;H3FC;H3FD;H3FF;H3FH;H3FI;H3FJ;H3FK;H3FL;H3FM;H3FN;HIST1H3A;HIST1H3B;HIST1H3C;HIST1H3D;HIST1H3E;HIST1H3F;HIST1H3G;HIST1H3H;HIST1H3I;HIST1H3J;HIST2H3A;HIST2H3C;HIST2H3D;histone 1, H3a;histone 1, H3b;histone 1, H3c;histone 1, H3d;histone 1, H3e;histone 1, H3f;histone 1, H3g;histone 1, H3h;histone 1, H3i;histone 1, H3j;histone 2, H3a;histone 2, H3c;histone 2, H3d;histone cluster 1 H3 family member a;histone cluster 1 H3 family member b;histone cluster 1 H3 family member c;histone cluster 1 H3 family member d;histone cluster 1 H3 family member e;histone cluster 1 H3 family member f;histone cluster 1 H3 family member g;histone cluster 1 H3 family member h;histone cluster 1 H3 family member i;histone cluster 1 H3 family member j;histone cluster 1, H3a;histone cluster 1, H3b;histone cluster 1, H3c;histone cluster 1, H3d;histone cluster 1, H3e;histone cluster 1, H3f;histone cluster 1, H3g;histone cluster 1, H3h;histone cluster 1, H3i;histone cluster 1, H3j;histone cluster 2 H3 family member a;histone cluster 2 H3 family member c;histone cluster 2 H3 family member d;histone cluster 2, H3a;histone cluster 2, H3c;histone cluster 2, H3d;histone H3.1;histone H3.2;histone H3.3;histone H3/a;histone H3/b;histone H3/c;histone H3/d;histone H3/f;histone H3/h;histone H3/i;histone H3/j;histone H3/k;histone H3/l;histone H3/m;histone H3/o. |
NCBI Gene Id | 126961|3020|3021|333932|653604|8350|8351|8352|8353|8354|8355|8356|8357|8358|8968 |
Protein Name | Histone H3.1|Histone H3.2|Histone H3.3 |
Description of Target | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.|Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. Constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. |
Uniprot ID | P68431|P84243|Q71DI3 |
Molecular Weight | 15 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "Histone H3 Antibody (Phospho-Thr11) (OAAF07471)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "Histone H3 Antibody (Phospho-Thr11) (OAAF07471)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "Histone H3 Antibody (Phospho-Thr11) (OAAF07471)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Histone H3 Antibody (Phospho-Thr11) (OAAF07471)"?
This target may also be called "H3;H3 histone family member 3A;H3 histone family member 3B;H3 histone family, member A;H3 histone family, member B;H3 histone family, member C;H3 histone family, member D;H3 histone family, member F;H3 histone family, member H;H3 histone family, member I;H3 histone family, member J;H3 histone family, member K;H3 histone family, member L;H3 histone family, member M;H3 histone, family 2;H3 histone, family 3A;H3 histone, family 3B (H3.3B);H3.1;H3.2;H3.3A;H3.3B;H3.f;H3/A;H3/b;H3/c;H3/d;H3/f;H3/h;H3/i;H3/j;H3/k;H3/l;H3/M;H3/n;H3/o;H3-3A;H3-3B;H3C1;H3C10;H3C11;H3C12;H3C13;H3C14;H3C15;H3C2;H3C3;H3C4;H3C6;H3C7;H3C8;H3-clustered histone 13;H3-clustered histone 14;H3-clustered histone 15;H3F1K;H3F2;H3F3;H3F3A;H3F3B;H3FA;H3FB;H3FC;H3FD;H3FF;H3FH;H3FI;H3FJ;H3FK;H3FL;H3FM;H3FN;HIST1H3A;HIST1H3B;HIST1H3C;HIST1H3D;HIST1H3E;HIST1H3F;HIST1H3G;HIST1H3H;HIST1H3I;HIST1H3J;HIST2H3A;HIST2H3C;HIST2H3D;histone 1, H3a;histone 1, H3b;histone 1, H3c;histone 1, H3d;histone 1, H3e;histone 1, H3f;histone 1, H3g;histone 1, H3h;histone 1, H3i;histone 1, H3j;histone 2, H3a;histone 2, H3c;histone 2, H3d;histone cluster 1 H3 family member a;histone cluster 1 H3 family member b;histone cluster 1 H3 family member c;histone cluster 1 H3 family member d;histone cluster 1 H3 family member e;histone cluster 1 H3 family member f;histone cluster 1 H3 family member g;histone cluster 1 H3 family member h;histone cluster 1 H3 family member i;histone cluster 1 H3 family member j;histone cluster 1, H3a;histone cluster 1, H3b;histone cluster 1, H3c;histone cluster 1, H3d;histone cluster 1, H3e;histone cluster 1, H3f;histone cluster 1, H3g;histone cluster 1, H3h;histone cluster 1, H3i;histone cluster 1, H3j;histone cluster 2 H3 family member a;histone cluster 2 H3 family member c;histone cluster 2 H3 family member d;histone cluster 2, H3a;histone cluster 2, H3c;histone cluster 2, H3d;histone H3.1;histone H3.2;histone H3.3;histone H3/a;histone H3/b;histone H3/c;histone H3/d;histone H3/f;histone H3/h;histone H3/i;histone H3/j;histone H3/k;histone H3/l;histone H3/m;histone H3/o." in publications.
-
What is the shipping cost for "Histone H3 Antibody (Phospho-Thr11) (OAAF07471)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "Histone H3 Antibody (Phospho-Thr11) (OAAF07471)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Histone H3 Antibody (Phospho-Thr11) (OAAF07471)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "15 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Histone H3 Antibody (Phospho-Thr11) (OAAF07471)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "H3-3A|H3-3B|H3C1|H3C10|H3C11|H3C12|H3C13|H3C14|H3C15|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "H3-3A|H3-3B|H3C1|H3C10|H3C11|H3C12|H3C13|H3C14|H3C15|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "H3-3A|H3-3B|H3C1|H3C10|H3C11|H3C12|H3C13|H3C14|H3C15|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "H3-3A|H3-3B|H3C1|H3C10|H3C11|H3C12|H3C13|H3C14|H3C15|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "H3-3A|H3-3B|H3C1|H3C10|H3C11|H3C12|H3C13|H3C14|H3C15|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "H3-3A|H3-3B|H3C1|H3C10|H3C11|H3C12|H3C13|H3C14|H3C15|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.