Search Antibody, Protein, and ELISA Kit Solutions

H2AFZ Antibody - N-terminal region : FITC (ARP74551_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74551_P050 Unconjugated

ARP74551_P050-HRP Conjugated

ARP74551_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
H2A histone family member Z
NCBI Gene Id:
Protein Name:
histone H2A.Z
Swissprot Id:
Protein Accession #:
Alias Symbols:
H2AZ, H2A.z, H2A/z, H2A.Z-1
Description of Target:
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express H2AFZ.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express H2AFZ.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human H2AZ
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: GKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-H2AFZ (ARP74551_P050-FITC) antibody is Catalog # AAP74551
Printable datasheet for anti-H2AFZ (ARP74551_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...