Search Antibody, Protein, and ELISA Kit Solutions

GPX3 Antibody - N-terminal region (ARP41491_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41491_P050-FITC Conjugated

ARP41491_P050-HRP Conjugated

ARP41491_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Glutathione peroxidase 3 (plasma)
NCBI Gene Id:
Protein Name:
Glutathione peroxidase 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-50496 from Santa Cruz Biotechnology.
Description of Target:
GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme. GPX3 expression appears to be tissue-specific.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GPX3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GPX3.
The immunogen is a synthetic peptide directed towards the N terminal region of human GPX3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 83%; Guinea Pig: 79%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%
Complete computational species homology data:
Anti-GPX3 (ARP41491_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GPX3 (ARP41491_P050) antibody is Catalog # AAP41491 (Previous Catalog # AAPS09501)
Printable datasheet for anti-GPX3 (ARP41491_P050) antibody
Sample Type Confirmation:

GPX3 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Lee,O.J., (2005) Neoplasia 7 (9), 854-861

Maccarrone, G. et al. Psychiatric patient stratification using biosignatures based on cerebrospinal fluid protein expression clusters. J. Psychiatr. Res. 47, 1572-80 (2013). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat 23962679

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...