Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP41491_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41491_P050-FITC Conjugated

ARP41491_P050-HRP Conjugated

ARP41491_P050-Biotin Conjugated

GPX3 Antibody - N-terminal region (ARP41491_P050)

Catalog#: ARP41491_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-50496 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GPX3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 83%; Guinea Pig: 79%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%
Complete computational species homology data Anti-GPX3 (ARP41491_P050)
Peptide Sequence Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GPX3 (ARP41491_P050) antibody is Catalog # AAP41491 (Previous Catalog # AAPS09501)
Datasheets/Manuals Printable datasheet for anti-GPX3 (ARP41491_P050) antibody
Sample Type Confirmation

GPX3 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Lee,O.J., (2005) Neoplasia 7 (9), 854-861
Publications

Maccarrone, G. et al. Psychiatric patient stratification using biosignatures based on cerebrospinal fluid protein expression clusters. J. Psychiatr. Res. 47, 1572-80 (2013). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat 23962679

Gene Symbol GPX3
Official Gene Full Name Glutathione peroxidase 3 (plasma)
Alias Symbols GPx-P, GSHPx-3, GSHPx-P
NCBI Gene Id 2878
Protein Name Glutathione peroxidase 3
Description of Target GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme. GPX3 expression appears to be tissue-specific.
Swissprot Id P22352
Protein Accession # NP_002075
Nucleotide Accession # NM_002084
Protein Size (# AA) 226
Molecular Weight 25kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GPX3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GPX3.
Protein Interactions UBQLN1; GPX3;
  1. What is the species homology for "GPX3 Antibody - N-terminal region (ARP41491_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat".

  2. How long will it take to receive "GPX3 Antibody - N-terminal region (ARP41491_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GPX3 Antibody - N-terminal region (ARP41491_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GPX3 Antibody - N-terminal region (ARP41491_P050)"?

    This target may also be called "GPx-P, GSHPx-3, GSHPx-P" in publications.

  5. What is the shipping cost for "GPX3 Antibody - N-terminal region (ARP41491_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GPX3 Antibody - N-terminal region (ARP41491_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GPX3 Antibody - N-terminal region (ARP41491_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GPX3 Antibody - N-terminal region (ARP41491_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GPX3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GPX3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GPX3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GPX3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GPX3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GPX3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GPX3 Antibody - N-terminal region (ARP41491_P050)
Your Rating
We found other products you might like!