Catalog No: ARP41491_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP41491_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

GPX3 Antibody - N-terminal region : FITC (ARP41491_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-GPX3 (ARP41491_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GPX3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 83%; Guinea Pig: 79%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI
Concentration0.5 mg/ml
Blocking PeptideFor anti-GPX3 (ARP41491_P050-FITC) antibody is Catalog # AAP41491 (Previous Catalog # AAPS09501)
Sample Type Confirmation

GPX3 is strongly supported by BioGPS gene expression data to be expressed in HepG2

ReferenceLee,O.J., (2005) Neoplasia 7 (9), 854-861
Publications

Maccarrone, G. et al. Psychiatric patient stratification using biosignatures based on cerebrospinal fluid protein expression clusters. J. Psychiatr. Res. 47, 1572-80 (2013). IHC, ICC/IF, Mouse, Human, Bovine, Rat, Pig, Dog, Guinea pig 23962679

Gene SymbolGPX3
Gene Full NameGlutathione peroxidase 3 (plasma)
Alias SymbolsGPx-P, GSHPx-3, GSHPx-P
NCBI Gene Id2878
Protein NameGlutathione peroxidase 3
Description of TargetGPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme. GPX3 expression appears to be tissue-specific.
Uniprot IDP22352
Protein Accession #NP_002075
Nucleotide Accession #NM_002084
Protein Size (# AA)226
Molecular Weight25kDa
Protein InteractionsUBQLN1; GPX3;
  1. What is the species homology for "GPX3 Antibody - N-terminal region : FITC (ARP41491_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig".

  2. How long will it take to receive "GPX3 Antibody - N-terminal region : FITC (ARP41491_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GPX3 Antibody - N-terminal region : FITC (ARP41491_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GPX3 Antibody - N-terminal region : FITC (ARP41491_P050-FITC)"?

    This target may also be called "GPx-P, GSHPx-3, GSHPx-P" in publications.

  5. What is the shipping cost for "GPX3 Antibody - N-terminal region : FITC (ARP41491_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GPX3 Antibody - N-terminal region : FITC (ARP41491_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GPX3 Antibody - N-terminal region : FITC (ARP41491_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GPX3 Antibody - N-terminal region : FITC (ARP41491_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GPX3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GPX3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GPX3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GPX3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GPX3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GPX3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GPX3 Antibody - N-terminal region : FITC (ARP41491_P050-FITC)
Your Rating
We found other products you might like!