Size:100ug
$199.00
In Stock
SKU
AEP10054
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

GCLM Protein (AEP10054)

Catalog#: AEP10054
Domestic: within 1 week delivery | International: 1 week
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Lyophilized powder
Application WB
Reconstitution and Storage Reconstitute with distilled water. For longer periods of storage, store at -20C. Avoid repeat freeze and thaw cycles.
Replacement Item This antibody may replace item sc-166603 from Santa Cruz Biotechnology.
Protein Sequence MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTAPDQFIGIFAQNRPEWVIIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRC
Tag GST in N-terminal
Quality Control This product was tested on western blot.
Application : Western blot standard.
Observed Molecular Weight: 60
Protein Purity : 90%
Expression system : Bacteria
Datasheets/Manuals Printable datasheet for anti-GCLM (AEP10054) antibody
Gene Symbol GCLM
Alias Symbols GLCLR
NCBI Gene Id 2730
Protein Name Glutamate--cysteine ligase regulatory subunit
Description of Target Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.
Swissprot Id P48507
Protein Accession # NP_002052
Nucleotide Accession # NM_002061
Molecular Weight 60
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GCLM.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GCLM.
Protein Interactions UBC; NAGK; GLRX3; GNAI2; GCLC; STOX1; IRF7; CALM1; SORD; CUL3;
Write Your Own Review
You're reviewing:GCLM Protein (AEP10054)
Your Rating
We found other products you might like!