Search Antibody, Protein, and ELISA Kit Solutions

GCLM Protein (AEP10054)

100ug
$199.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Lyophilized powder
Application:
WB
Reconstitution and Storage:
Reconstitute with distilled water. For longer periods of storage, store at -20C. Avoid repeat freeze and thaw cycles.
Gene Symbol:
GCLM
Alias Symbols:
GLCLR
NCBI Gene Id:
2730
Replacement Item:
This antibody may replace item sc-166603 from Santa Cruz Biotechnology.
Protein Name:
Glutamate--cysteine ligase regulatory subunit
Description of Target:
Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.
Swissprot Id:
P48507
Protein Accession #:
NP_002052
Nucleotide Accession #:
NM_002061
Molecular Weight:
60
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GCLM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GCLM.
Protein Interactions:
UBC; NAGK; GLRX3; GNAI2; GCLC; STOX1; IRF7; CALM1; SORD; CUL3;
Protein Sequence:
MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTAPDQFIGIFAQNRPEWVIIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRC
Tag:
GST in N-terminal
Quality Control:
This product was tested on western blot.
Application : Western blot standard.
Observed Molecular Weight: 60
Protein Purity : 90%
Expression system : Bacteria
Datasheets/Manuals:
Printable datasheet for anti-GCLM (AEP10054) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...