Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

GCLM Antibody - middle region (ARP54624_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54624_P050-FITC Conjugated

ARP54624_P050-HRP Conjugated

ARP54624_P050-Biotin Conjugated

Gene Symbol:
GCLM
Official Gene Full Name:
Glutamate-cysteine ligase, modifier subunit
NCBI Gene Id:
2730
Protein Name:
Glutamate--cysteine ligase regulatory subunit
Swissprot Id:
P48507
Protein Accession #:
NP_002052
Nucleotide Accession #:
NM_002061
Alias Symbols:
GLCLR
Replacement Item:
This antibody may replace item sc-166603, HPA023696
Description of Target:
Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
274
Molecular Weight:
31kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GCLM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GCLM.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GCLM
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-GCLM (ARP54624_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; NAGK; GLRX3; GNAI2; GCLC; STOX1; IRF7; CALM1; SORD; CUL3;
Blocking Peptide:
For anti-GCLM (ARP54624_P050) antibody is Catalog # AAP54624 (Previous Catalog # AAPP31415)
Datasheets/Manuals:
Printable datasheet for anti-GCLM (ARP54624_P050) antibody
Additional Information:
IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Jonsson,L.S., (2008) Int Arch Occup Environ Health 81 (7), 913-919
Publications:

Ramani, K., Tomasi, M. L., Yang, H., Ko, K. & Lu, S. C. Mechanism and significance of changes in glutamate-cysteine ligase expression during hepatic fibrogenesis. J. Biol. Chem. 287, 36341-55 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22942279

Tomasi, M. L. et al. Molecular mechanisms of lipopolysaccharide-mediated inhibition of glutathione synthesis in mice. Free Radic. Biol. Med. 68, 148-58 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24296246

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...