Search Antibody, Protein, and ELISA Kit Solutions

GATA6 antibody - middle region (ARP31859_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31859_P050-FITC Conjugated

ARP31859_P050-HRP Conjugated

ARP31859_P050-Biotin Conjugated

Gene Symbol:
GATA6
NCBI Gene Id:
2627
Official Gene Full Name:
GATA binding protein 6
Protein Name:
Transcription factor GATA-6
Swissprot Id:
Q92908
Protein Accession #:
NP_005248
Nucleotide Accession #:
NM_005257
Alias Symbols:
ASD9, AVSD5, PACHD
Replacement Item:
This antibody may replace item sc-293173 from Santa Cruz Biotechnology.
Description of Target:
GATA6 is thought to be important for regulating terminal differentiation and/or proliferation.
Protein Size (# AA):
595
Molecular Weight:
60kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GATA6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GATA6.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GATA6
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 93%; Rat: 86%; Sheep: 93%
Complete computational species homology data:
Anti-GATA6 (ARP31859_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KPNA3; SP1; CDK9; HHEX; MED1; EP300; CRIP2; NKX2-1; KLF2;
Blocking Peptide:
For anti-GATA6 (ARP31859_P050) antibody is Catalog # AAP31859 (Previous Catalog # AAPP02654)
Datasheets/Manuals:
Printable datasheet for anti-GATA6 (ARP31859_P050) antibody
Target Reference:
Ghatnekar,A. (2008) Biochim. Biophys. Acta 1779 (3), 145-151
Publications:

Kallas, A., Pook, M., Trei, A. & Maimets, T. SOX2 Is Regulated Differently from NANOG and OCT4 in Human Embryonic Stem Cells during Early Differentiation Initiated with Sodium Butyrate. Stem Cells Int. 2014, 298163 (2014). IF, IHC, WB, Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 24707296

Product Reviews

Average Rating:
2 reviews
5 star
1
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

2 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: GATA6 antibody-middle region (ARP31859_P050) in mouse tumor lysate using Western blot
Product Page for GATA6 antibody-middle region (ARP31859_P050)

Researcher: Dr. Jonahan Kurie, UT MD Anderson Cancer center
Application: Western blotting
Sample type: 1: 25 ug mouse tumor + shRNA1, 2: 25 ug mouse tumor + shRNA2, 3: 25 ug mouse tumor lysate
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:3500


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? The Aviva antibodies were used to detect corresponding protein levels in mouse cell lines.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4. The antibody is relatively good, and has minimal background
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? No
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes. The antibody recognizes mGATA6 protein with minimal background.
How did you store the antibody after re-suspension? Aliquots were stored at -80C for long term use and at -20C for short term use
How many different experimental trials were conducted using the antibody sample?  2-3
How was this sample prepared? The sample was prepared using the reagent and protocol from "MPER lysis"  from Pierce company.
Primary antibody dilution and incubation time: 1:1000, overnight.
Secondary antibody used and dilution and incubation time: Cell Signaling anti rabbit antibody, 1:3500.
What controls were used in your experiment (positive/negative)? Transcript knockdowns with ~70% efficiency were used as controls.
Please include your detailed WB Procedure/Protocol here: The protocol is from Pierce (MPER lysis), and is accessible online.
0
0
Reply
Show more comments (-2) Hide comments
02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: GATA6 antibody -middle region (ARP31859_P050) in Human H9 cells and Human H9 cells+Na+Butyrate using FC
Product Page for GATA6 antibody-middle region (ARP31859_P050)

Application: Flow Cytometry
Researcher: Dr. Ade Kallas, University of tartu
Species + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+Butyrate
Primary antibody dilution: 2ug+1x106 cells
Secondary antibody: Chicken anti rabbit-Alexa Fluor 488
Secondary antibody dilution: 1:1000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? Different antibodies are used to detect antigens in cells for studying their expression profile.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? No
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes. This antibody will be included into panel of antibodies used for detecting differentation of human embryonic stem cells.
How did you store the antibody after re-suspension? One week at 4 C, then aliquots at -20 C for longer period.
Sample Description (please include species type and tissue/cell type): Human embryonic stem cells (H9 cell line, Wicell, USA) in pluripotent state and at day 3 of differentiation initiated with Sodium Butyrate.
How many different experimental trials were conducted using the antibody sample? Cells at pluripotent state and at differentiation (Day 3) were analysed 3 times.
Primary antibody dilution, incubation time and temperature, conjugate type (fluorophore, quantum dot, isotope, etc. ) used: 2 ul of antibody solution (1mg/ml) was used to stain 1x106 cells for 30 min at RT. Another sample was stained in the same conditions with isotype control antibody (Rabbit IgG, ChiP grade, Abcam). Isotype control antibody was added in the amount equal with anti-GATA6 antibody protein concentration.
Other labeling reagents used (please include dilution, incubation time and temperature and conjugate type): As a secondary regaent we used chicken anti-rabbit IgG conjugated with Alexa Fluor 488 (e-Bioscience) at dilution 1:1000 in 100 ul PBS (caontaining 1% BSA, and 2mM EDTA) for 30 min at RT.
What controls were used in your experiment? Rabbit IgG (Chip grade, Abcam) was used as an isotype control in every experiment.
AS a biological negative control we used pluripotent undifferentiated hESC cells and for positive control
differentiated hESC cells (hESC treated with Sodium Butyrate for 3 days according to differentiation protocol to induce cells of endodermal lineage) were used.
From your Flow images, briefly explain the different populations represented: Histogram with black line represents the staining with GATA6 antibody (Day 0 and Day 3 at differentiation).
Histogram with red line represents the staining with isotype control antibody. There is a detectable shift in fluorecsence intensity of cell population representing cells expressing GATA6 at Day 3. The GATA6 positive and GATA6 negative populations were detected separately to each other.
0
0
Reply
Show more comments (-2) Hide comments

2 Item(s)

What kind of abuse are you reporting?
    Please, wait...