GATA6 Antibody - middle region (ARP31859_P050)

Data Sheet
 
Product Number ARP31859_P050
Product Page www.avivasysbio.com/gata6-antibody-middle-region-arp31859-p050.html
Name GATA6 Antibody - middle region (ARP31859_P050)
Protein Size (# AA) 595 amino acids
Molecular Weight 60kDa
NCBI Gene Id 2627
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name GATA binding protein 6
Alias Symbols ASD9, AVSD5, PACHD
Peptide Sequence Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ghatnekar,A. (2008) Biochim. Biophys. Acta 1779 (3), 145-151
Description of Target GATA6 is thought to be important for regulating terminal differentiation and/or proliferation.
Protein Interactions KPNA3; SP1; CDK9; HHEX; MED1; EP300; CRIP2; NKX2-1; KLF2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GATA6 (ARP31859_P050) antibody
Other Applications Image 1 Data Immunofluorescence: Human Embryonic Stem Cell Line
Dilution: 1:250
Blocking Peptide For anti-GATA6 (ARP31859_P050) antibody is Catalog # AAP31859 (Previous Catalog # AAPP02654)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GATA6
Uniprot ID Q92908
Protein Name Transcription factor GATA-6
Publications

Kallas, A., Pook, M., Trei, A. & Maimets, T. SOX2 Is Regulated Differently from NANOG and OCT4 in Human Embryonic Stem Cells during Early Differentiation Initiated with Sodium Butyrate. Stem Cells Int. 2014, 298163 (2014). 24707296

Protein Accession # NP_005248
Purification Affinity Purified
Nucleotide Accession # NM_005257
Tested Species Reactivity Human
Gene Symbol GATA6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Sheep
Application IF, IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 93%; Rat: 86%; Sheep: 93%
Image 1
Human Embryonic Stem
The cells are human embryonic stem cell line H1 differentiated to HNF4 positive hepatic progenitor cells. The antibodies were used at a 1:250 dilution.
Image 2
Human Colon
Rabbit Anti-GATA6 Antibody
Catalog Number: ARP31859
Paraffin Embedded Tissue: Human Colon
Antibody Concentration: 5 ug/ml
Image 3
HepG2 Cell Lysate, Human Brain
Host: Rabbit
Target: GATA6
Positive control (+): HepG2 Cell Lysate (HG)
Negative control (-): Human Brain (BR)
Antibody concentration: 1ug/ml
Image 4
Human MCF7
WB Suggested Anti-GATA6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com