Product Number |
ARP31859_P050 |
Product Page |
www.avivasysbio.com/gata6-antibody-middle-region-arp31859-p050.html |
Name |
GATA6 Antibody - middle region (ARP31859_P050) |
Protein Size (# AA) |
595 amino acids |
Molecular Weight |
60kDa |
NCBI Gene Id |
2627 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
GATA binding protein 6 |
Alias Symbols |
ASD9, AVSD5, PACHD |
Peptide Sequence |
Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ghatnekar,A. (2008) Biochim. Biophys. Acta 1779 (3), 145-151 |
Description of Target |
GATA6 is thought to be important for regulating terminal differentiation and/or proliferation. |
Protein Interactions |
KPNA3; SP1; CDK9; HHEX; MED1; EP300; CRIP2; NKX2-1; KLF2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GATA6 (ARP31859_P050) antibody |
Other Applications Image 1 Data |
Immunofluorescence: Human Embryonic Stem Cell Line Dilution: 1:250 |
Blocking Peptide |
For anti-GATA6 (ARP31859_P050) antibody is Catalog # AAP31859 (Previous Catalog # AAPP02654) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GATA6 |
Uniprot ID |
Q92908 |
Protein Name |
Transcription factor GATA-6 |
Publications |
Kallas, A., Pook, M., Trei, A. & Maimets, T. SOX2 Is Regulated Differently from NANOG and OCT4 in Human Embryonic Stem Cells during Early Differentiation Initiated with Sodium Butyrate. Stem Cells Int. 2014, 298163 (2014). 24707296 |
Protein Accession # |
NP_005248 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005257 |
Tested Species Reactivity |
Human |
Gene Symbol |
GATA6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Sheep |
Application |
IF, IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 93%; Rat: 86%; Sheep: 93% |
Image 1 | Human Embryonic Stem
| The cells are human embryonic stem cell line H1 differentiated to HNF4 positive hepatic progenitor cells. The antibodies were used at a 1:250 dilution. |
|
Image 2 | Human Colon
| Rabbit Anti-GATA6 Antibody Catalog Number: ARP31859 Paraffin Embedded Tissue: Human Colon Antibody Concentration: 5 ug/ml |
|
Image 3 | HepG2 Cell Lysate, Human Brain
| Host: Rabbit Target: GATA6 Positive control (+): HepG2 Cell Lysate (HG) Negative control (-): Human Brain (BR) Antibody concentration: 1ug/ml |
|
Image 4 | Human MCF7
| WB Suggested Anti-GATA6 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysate |
|