Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38096_T100-FITC Conjugated

ARP38096_T100-HRP Conjugated

ARP38096_T100-Biotin Conjugated

FLI1 Antibody - N-terminal region (ARP38096_T100)

Catalog#: ARP38096_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Pig
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-134223 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FLI1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-FLI1 (ARP38096_T100)
Peptide Sequence Synthetic peptide located within the following region: MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FLI1 (ARP38096_T100) antibody is Catalog # AAP38096 (Previous Catalog # AAPP20270)
Datasheets/Manuals Printable datasheet for anti-FLI1 (ARP38096_T100) antibody
Sample Type Confirmation

FLI1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference van den Akker,E., et al., (2005) J. Biol. Chem. 280 (45), 38035-38046

Bujor, A. M. et al. Ciprofloxacin has antifibrotic effects in scleroderma fibroblasts via downregulation of Dnmt1 and upregulation of Fli1. Int. J. Mol. Med. 30, 1473-80 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23041765

Gene Symbol FLI1
Official Gene Full Name Friend leukemia virus integration 1
Alias Symbols EWSR2, SIC-1
NCBI Gene Id 2313
Protein Name Friend leukemia integration 1 transcription factor
Description of Target Friend leukemia integration 1 (Fli-1) is a member of the ETS family of transcriptional regulatory proteins that contain a highly conserved and structurally unique DNA binding ETS domain.
Swissprot Id Q01543
Protein Accession # NP_002008
Nucleotide Accession # NM_002017
Protein Size (# AA) 452
Molecular Weight 51kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FLI1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FLI1.
  1. What is the species homology for "FLI1 Antibody - N-terminal region (ARP38096_T100)"?

    The tested species reactivity for this item is "Human, Pig". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "FLI1 Antibody - N-terminal region (ARP38096_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FLI1 Antibody - N-terminal region (ARP38096_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "FLI1 Antibody - N-terminal region (ARP38096_T100)"?

    This target may also be called "EWSR2, SIC-1" in publications.

  5. What is the shipping cost for "FLI1 Antibody - N-terminal region (ARP38096_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FLI1 Antibody - N-terminal region (ARP38096_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FLI1 Antibody - N-terminal region (ARP38096_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FLI1 Antibody - N-terminal region (ARP38096_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FLI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FLI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FLI1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FLI1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FLI1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FLI1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FLI1 Antibody - N-terminal region (ARP38096_T100)
Your Rating