Search Antibody, Protein, and ELISA Kit Solutions

FLI1 Antibody - N-terminal region (ARP38096_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38096_T100-FITC Conjugated

ARP38096_T100-HRP Conjugated

ARP38096_T100-Biotin Conjugated

Tested Species Reactivity:
Human, Pig
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-134223 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human FLI1
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-FLI1 (ARP38096_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FLI1 (ARP38096_T100) antibody is Catalog # AAP38096 (Previous Catalog # AAPP20270)
Printable datasheet for anti-FLI1 (ARP38096_T100) antibody
Sample Type Confirmation:

FLI1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
van den Akker,E., et al., (2005) J. Biol. Chem. 280 (45), 38035-38046

Bujor, A. M. et al. Ciprofloxacin has antifibrotic effects in scleroderma fibroblasts via downregulation of Dnmt1 and upregulation of Fli1. Int. J. Mol. Med. 30, 1473-80 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23041765

Gene Symbol:
Official Gene Full Name:
Friend leukemia virus integration 1
Alias Symbols:
NCBI Gene Id:
Protein Name:
Friend leukemia integration 1 transcription factor
Description of Target:
Friend leukemia integration 1 (Fli-1) is a member of the ETS family of transcriptional regulatory proteins that contain a highly conserved and structurally unique DNA binding ETS domain.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FLI1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FLI1.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...