FABP3 Recombinant Protein (Rat) (OPCA03689)

Catalog No: OPCA03689

Product Info

• Predicted Species Reactivity: Rat|Rattus norvegicus
• Product Format: Liquid or Lyophilized powder
• Host: Rat
• Additional Information: Relevance: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA
• Protein Sequence: ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mammalian Cells
• Protein Range: 2-133 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Cloning and tissue distribution of rat heart fatty acid binding protein mRNA: identical forms in heart and skeletal muscle.Claffey K.P., Herrera V.L., Brecher P., Ruiz-Opazo N.Biochemistry 26:7900-7904(1987)

Target Info

• Gene Symbol: Fabp3
• Gene Full Name: fatty acid binding protein 3
• Alias Symbols: Fatty acid binding protein 3 heart;fatty acid binding protein 3, muscle and heart;Fatty acid-binding protein 3;fatty acid-binding protein, heart;heart fatty acid binding protein;heart-type fatty acid-binding protein;H-FABP.
• NCBI Gene Id: 79131
• Protein Name: Fatty acid-binding protein, heart
• Description of Target: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
• Uniprot ID: P07483
• Protein Accession #: NP_077076.1
  
• Nucleotide Accession #: NM_024162.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 18.6 kDa