Catalog No: OPCA03689
Price: $0.00
SKU
OPCA03689
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for FABP3 Recombinant Protein (Rat) (OPCA03689) (OPCA03689) |
---|
Predicted Species Reactivity | Rat|Rattus norvegicus |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Rat |
Additional Information | Relevance: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA |
Protein Sequence | ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Mammalian Cells |
Protein Range | 2-133 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Cloning and tissue distribution of rat heart fatty acid binding protein mRNA: identical forms in heart and skeletal muscle.Claffey K.P., Herrera V.L., Brecher P., Ruiz-Opazo N.Biochemistry 26:7900-7904(1987) |
Gene Symbol | Fabp3 |
---|---|
Gene Full Name | fatty acid binding protein 3 |
Alias Symbols | Fatty acid binding protein 3 heart;fatty acid binding protein 3, muscle and heart;Fatty acid-binding protein 3;fatty acid-binding protein, heart;heart fatty acid binding protein;heart-type fatty acid-binding protein;H-FABP. |
NCBI Gene Id | 79131 |
Protein Name | Fatty acid-binding protein, heart |
Description of Target | FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. |
Uniprot ID | P07483 |
Protein Accession # | NP_077076.1 |
Nucleotide Accession # | NM_024162.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 18.6 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!