- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-F13B (ARP41999_P050-FITC) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human F13B |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-F13B (ARP41999_P050-FITC) antibody is Catalog # AAP41999 (Previous Catalog # AAPS11404) |
Reference | Pruissen,D.M., (2008) Blood 111 (3), 1282-1286 |
Gene Symbol | F13B |
---|---|
Gene Full Name | Coagulation factor XIII, B polypeptide |
Alias Symbols | FXIIIB |
NCBI Gene Id | 2165 |
Protein Name | Coagulation factor XIII B chain |
Description of Target | F13B contains 10 Sushi (CCP/SCR) domains. The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin. Defects in F13B can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.This gene encodes coagulation factor XIII B subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as a plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon activation by the cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P05160 |
Protein Accession # | NP_001985 |
Nucleotide Accession # | NM_001994 |
Protein Size (# AA) | 661 |
Molecular Weight | 73kDa |
Protein Interactions | FGG; F13A1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "F13B Antibody - middle region : FITC (ARP41999_P050-FITC)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".
-
How long will it take to receive "F13B Antibody - middle region : FITC (ARP41999_P050-FITC)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "F13B Antibody - middle region : FITC (ARP41999_P050-FITC)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "F13B Antibody - middle region : FITC (ARP41999_P050-FITC)"?
This target may also be called "FXIIIB" in publications.
-
What is the shipping cost for "F13B Antibody - middle region : FITC (ARP41999_P050-FITC)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "F13B Antibody - middle region : FITC (ARP41999_P050-FITC)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "F13B Antibody - middle region : FITC (ARP41999_P050-FITC)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "73kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "F13B Antibody - middle region : FITC (ARP41999_P050-FITC)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "F13B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "F13B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "F13B"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "F13B"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "F13B"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "F13B"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.