Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

F13B antibody - middle region (ARP41999_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP41999_P050-FITC Conjugated

ARP41999_P050-HRP Conjugated

ARP41999_P050-Biotin Conjugated

Gene Symbol:
F13B
NCBI Gene Id:
2165
Official Gene Full Name:
Coagulation factor XIII, B polypeptide
Protein Name:
Coagulation factor XIII B chain
Swissprot Id:
P05160
Protein Accession #:
NP_001985
Nucleotide Accession #:
NM_001994
Alias Symbols:
FXIIIB
Replacement Item:
This antibody may replace item sc-135149 from Santa Cruz Biotechnology.
Description of Target:
F13B contains 10 Sushi (CCP/SCR) domains. The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin. Defects in F13B can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.This gene encodes coagulation factor XIII B subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as a plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon activation by the cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
661
Molecular Weight:
73kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express F13B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express F13B.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human F13B
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-F13B (ARP41999_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FGG; F13A1;
Blocking Peptide:
For anti-F13B (ARP41999_P050) antibody is Catalog # AAP41999 (Previous Catalog # AAPS11404)
Datasheets/Manuals:
Printable datasheet for anti-F13B (ARP41999_P050) antibody
Target Reference:
Pruissen,D.M., (2008) Blood 111 (3), 1282-1286

Tell us what you think about this item!

Write A Review
    Please, wait...