Search Antibody, Protein, and ELISA Kit Solutions

F10 Antibody - C-terminal region (ARP41753_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP41753_P050-FITC Conjugated

ARP41753_P050-HRP Conjugated

ARP41753_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
F10
Official Gene Full Name:
Coagulation factor X
NCBI Gene Id:
2159
Protein Name:
Coagulation factor X
Swissprot Id:
P00742
Protein Accession #:
NP_000495
Nucleotide Accession #:
NM_000504
Alias Symbols:
FX, FXA
Replacement Item:
This antibody may replace item sc-69654 from Santa Cruz Biotechnology.
Description of Target:
F10 is the vitamin K-dependent coagulation factor X of the blood coagulation cascade. This factor undergoes multiple processing steps before its preproprotein is converted to a mature two-chain form by the excision of the tripeptide RKR. Two chains of the factor are held together by 1 or more disulfide bonds; the light chain contains 2 EGF-like domains, while the heavy chain contains the catalytic domain which is structurally homologous to those of the other hemostatic serine proteases. The mature factor is activated by the cleavage of the activation peptide by factor IXa (in the intrisic pathway), or by factor VIIa (in the extrinsic pathway). The activated factor then converts prothrombin to thrombin in the presence of factor Va, Ca+2, and phospholipid during blood clotting.This gene encodes the vitamin K-dependent coagulation factor X of the blood coagulation cascade. This factor undergoes multiple processing steps before its preproprotein is converted to a mature two-chain form by the excision of the tripeptide RKR. Two chains of the factor are held together by 1 or more disulfide bonds; the light chain contains 2 EGF-like domains, while the heavy chain contains the catalytic domain which is structurally homologous to those of the other hemostatic serine proteases. The mature factor is activated by the cleavage of the activation peptide by factor IXa (in the intrisic pathway), or by factor VIIa (in the extrinsic pathway). The activated factor then converts prothrombin to thrombin in the presence of factor Va, Ca+2, and phospholipid during blood clotting. Mutations of this gene result in factor X deficiency, a hemorrhagic condition of variable severity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
488
Molecular Weight:
29kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express F10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express F10.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human F10
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 86%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-F10 (ARP41753_P050)
Peptide Sequence:
Synthetic peptide located within the following region: STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; GAD2; SERPINA10; HIST1H1C; MGST3; PRKAB1; SERPINA5; SERPINB8; F8; F10; F7; F5; PROS1; PLAT; PLG; SERPINB6; TFPI; APOH; GGCX; F3;
Blocking Peptide:
For anti-F10 (ARP41753_P050) antibody is Catalog # AAP41753 (Previous Catalog # AAPP24395)
Datasheets/Manuals:
Printable datasheet for anti-F10 (ARP41753_P050) antibody
Target Reference:
Hsu,H.J., (2008) J. Biol. Chem. 283 (18), 12343-12353

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...