SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP66568_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP66568_P050-HRP
Availability: Domestic: within 1 week delivery | International: 1 week
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

EPHA10 Antibody : HRP (ARP66568_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-EPHA10 (ARP66568_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence NLLHRLMLDCWQKDPGERPRFSQIHSILSKMVQDPEPPKCALTTCPRPPT
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Goat: 82%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 82%
Peptide SequenceSynthetic peptide located within the following region: NLLHRLMLDCWQKDPGERPRFSQIHSILSKMVQDPEPPKCALTTCPRPPT
Concentration0.5 mg/ml
Blocking PeptideAvailable upon request
Gene SymbolEPHA10
Gene Full NameEPH receptor A10
NCBI Gene Id284656
Protein NameEphrin type-A receptor 10
Description of TargetEphrin receptors, the largest subfamily of receptor tyrosine kinases (RTKs), and their ephrin ligands are important mediators of cell-cell communication regulating cell attachment, shape, and mobility in neuronal and epithelial cells (Aasheim et al., 2005 [PubMed 15777695]). See MIM 179610 for additional background on Eph receptors and ephrins.[supplied by OMIM, Mar 2008]
Uniprot IDQ5JZY3
Protein Accession #NP_001092909
Nucleotide Accession #NM_001099439
Protein Size (# AA)1,008
Molecular Weight110 kDa
Protein InteractionsBANP; TFCP2; FHL3; CAMK2D;
  1. What is the species homology for "EPHA10 Antibody : HRP (ARP66568_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "EPHA10 Antibody : HRP (ARP66568_P050-HRP)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "EPHA10 Antibody : HRP (ARP66568_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EPHA10 Antibody : HRP (ARP66568_P050-HRP)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "EPHA10 Antibody : HRP (ARP66568_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EPHA10 Antibody : HRP (ARP66568_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EPHA10 Antibody : HRP (ARP66568_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "110 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EPHA10 Antibody : HRP (ARP66568_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EPHA10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EPHA10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EPHA10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EPHA10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EPHA10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EPHA10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EPHA10 Antibody : HRP (ARP66568_P050-HRP)
Your Rating
We found other products you might like!