EPHA10 Antibody : Biotin (ARP66568_P050-Biotin)

Catalog No: ARP66568_P050-Biotin

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence NLLHRLMLDCWQKDPGERPRFSQIHSILSKMVQDPEPPKCALTTCPRPPT
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Goat: 82%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 82%
• Peptide Sequence: Synthetic peptide located within the following region: NLLHRLMLDCWQKDPGERPRFSQIHSILSKMVQDPEPPKCALTTCPRPPT
• Concentration: 0.5 mg/ml
• Blocking Peptide: Available upon request

Target Info

• Gene Symbol: EPHA10
• Gene Full Name: EPH receptor A10
• NCBI Gene Id: 284656
• Protein Name: Ephrin type-A receptor 10
• Description of Target: Ephrin receptors, the largest subfamily of receptor tyrosine kinases (RTKs), and their ephrin ligands are important mediators of cell-cell communication regulating cell attachment, shape, and mobility in neuronal and epithelial cells (Aasheim et al., 2005 [PubMed 15777695]). See MIM 179610 for additional background on Eph receptors and ephrins.[supplied by OMIM, Mar 2008]
• Uniprot ID: Q5JZY3
• Protein Accession #: NP_001092909
• Nucleotide Accession #: NM_001099439
• Protein Size (# AA): 1,008
• Molecular Weight: 110 kDa
• Protein Interactions: BANP; TFCP2; FHL3; CAMK2D;