SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP48203_T100-HRP
Size:100ul
Price: $384.00
SKU
ARP48203_T100-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ENO3 Antibody - N-terminal region : HRP (ARP48203_T100-HRP)

Datasheets/ManualsPrintable datasheet for anti-ENO3 (ARP48203_T100-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationIHC, WB
Additional InformationIHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ENO3
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR
Concentration0.5 mg/ml
Blocking PeptideFor anti-ENO3 (ARP48203_T100-HRP) antibody is Catalog # AAP48203 (Previous Catalog # AAPS22802)
Sample Type Confirmation

ENO3 is supported by BioGPS gene expression data to be expressed in HepG2

ReferenceLi,T.B., (2004) Acta Biochim. Biophys. Sin. (Shanghai) 36 (6), 412-418
Publications

Chaika, N. V et al. Differential expression of metabolic genes in tumor and stromal components of primary and metastatic loci in pancreatic adenocarcinoma. PLoS One 7, e32996 (2012). IHC, Bovine, Pig, Human, Dog, Horse, Rabbit, Rat, Goat, Guinea pig, Mouse, Yeast, Zebrafish 22412968

Gene SymbolENO3
Gene Full NameEnolase 3 (beta, muscle)
Alias SymbolsMSE, GSD13
NCBI Gene Id2027
Protein NameBeta-enolase
Description of TargetENO3 is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in ENO3 gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR.
Uniprot IDP13929
Protein Accession #NP_001967
Nucleotide Accession #NM_001976
Protein Size (# AA)434
Molecular Weight47kDa
Protein InteractionsUBC; IQCB1; DAK; PKM; GPI; ENO1; EEF1A1; APP; SUMO1; PNKD; TRIM63;
  1. What is the species homology for "ENO3 Antibody - N-terminal region : HRP (ARP48203_T100-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "ENO3 Antibody - N-terminal region : HRP (ARP48203_T100-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ENO3 Antibody - N-terminal region : HRP (ARP48203_T100-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ENO3 Antibody - N-terminal region : HRP (ARP48203_T100-HRP)"?

    This target may also be called "MSE, GSD13" in publications.

  5. What is the shipping cost for "ENO3 Antibody - N-terminal region : HRP (ARP48203_T100-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ENO3 Antibody - N-terminal region : HRP (ARP48203_T100-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ENO3 Antibody - N-terminal region : HRP (ARP48203_T100-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ENO3 Antibody - N-terminal region : HRP (ARP48203_T100-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ENO3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ENO3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ENO3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ENO3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ENO3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ENO3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ENO3 Antibody - N-terminal region : HRP (ARP48203_T100-HRP)
Your Rating
We found other products you might like!