Search Antibody, Protein, and ELISA Kit Solutions

ENO3 Antibody - N-terminal region (ARP48203_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48203_T100-FITC Conjugated

ARP48203_T100-HRP Conjugated

ARP48203_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Enolase 3 (beta, muscle)
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-133550 from Santa Cruz Biotechnology.
Description of Target:
ENO3 is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in ENO3 gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ENO3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ENO3.
The immunogen is a synthetic peptide directed towards the N terminal region of human ENO3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93%
Complete computational species homology data:
Anti-ENO3 (ARP48203_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ENO3 (ARP48203_T100) antibody is Catalog # AAP48203 (Previous Catalog # AAPS22802)
Printable datasheet for anti-ENO3 (ARP48203_T100) antibody
Sample Type Confirmation:

ENO3 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Li,T.B., (2004) Acta Biochim. Biophys. Sin. (Shanghai) 36 (6), 412-418

Chaika, N. V et al. Differential expression of metabolic genes in tumor and stromal components of primary and metastatic loci in pancreatic adenocarcinoma. PLoS One 7, e32996 (2012). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 22412968

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...