Size:100 ul
$229.00
In Stock
SKU
ARP48203_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48203_T100-FITC Conjugated

ARP48203_T100-HRP Conjugated

ARP48203_T100-Biotin Conjugated

ENO3 Antibody - N-terminal region (ARP48203_T100)

Catalog#: ARP48203_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-133550 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ENO3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93%
Complete computational species homology dataAnti-ENO3 (ARP48203_T100)
Peptide SequenceSynthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ENO3 (ARP48203_T100) antibody is Catalog # AAP48203 (Previous Catalog # AAPS22802)
Datasheets/ManualsPrintable datasheet for anti-ENO3 (ARP48203_T100) antibody
Sample Type Confirmation

ENO3 is supported by BioGPS gene expression data to be expressed in HepG2

Target ReferenceLi,T.B., (2004) Acta Biochim. Biophys. Sin. (Shanghai) 36 (6), 412-418
Publications

Chaika, N. V et al. Differential expression of metabolic genes in tumor and stromal components of primary and metastatic loci in pancreatic adenocarcinoma. PLoS One 7, e32996 (2012). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 22412968

Gene SymbolENO3
Official Gene Full NameEnolase 3 (beta, muscle)
Alias SymbolsMSE, GSD13
NCBI Gene Id2027
Protein NameBeta-enolase
Description of TargetENO3 is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in ENO3 gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR.
Swissprot IdP13929
Protein Accession #NP_001967
Nucleotide Accession #NM_001976
Protein Size (# AA)434
Molecular Weight47kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ENO3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ENO3.
Protein InteractionsUBC; IQCB1; DAK; PKM; GPI; ENO1; EEF1A1; APP; SUMO1; PNKD; TRIM63;
  1. What is the species homology for "ENO3 Antibody - N-terminal region (ARP48203_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish".

  2. How long will it take to receive "ENO3 Antibody - N-terminal region (ARP48203_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ENO3 Antibody - N-terminal region (ARP48203_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ENO3 Antibody - N-terminal region (ARP48203_T100)"?

    This target may also be called "MSE, GSD13" in publications.

  5. What is the shipping cost for "ENO3 Antibody - N-terminal region (ARP48203_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ENO3 Antibody - N-terminal region (ARP48203_T100)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "ENO3 Antibody - N-terminal region (ARP48203_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ENO3 Antibody - N-terminal region (ARP48203_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ENO3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ENO3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ENO3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ENO3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ENO3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ENO3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ENO3 Antibody - N-terminal region (ARP48203_T100)
Your Rating
Aviva Travel Grant
Aviva Tissue Tool
Assay Development
Aviva Blast Tool