ENO3 Antibody - N-terminal region (ARP48203_T100)

Catalog No: ARP48203_T100

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Human kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENO3
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-ENO3 (ARP48203_T100) antibody is Catalog # AAP48203 (Previous Catalog # AAPS22802)
• Sample Type Confirmation:

  ENO3 is supported by BioGPS gene expression data to be expressed in HepG2

• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Li,T.B., (2004) Acta Biochim. Biophys. Sin. (Shanghai) 36 (6), 412-418
• Publications:

  Chaika, N. V et al. Differential expression of metabolic genes in tumor and stromal components of primary and metastatic loci in pancreatic adenocarcinoma. PLoS One 7, e32996 (2012). 22412968

Target Info

• Gene Symbol: ENO3
• Gene Full Name: Enolase 3 (beta, muscle)
• Alias Symbols: MSE, GSD13
• NCBI Gene Id: 2027
• Protein Name: Beta-enolase
• Description of Target: ENO3 is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in ENO3 gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR.
• Uniprot ID: P13929
• Protein Accession #: NP_001967
• Nucleotide Accession #: NM_001976
• Protein Size (# AA): 434
• Molecular Weight: 47kDa
• Protein Interactions: UBC; IQCB1; DAK; PKM; GPI; ENO1; EEF1A1; APP; SUMO1; PNKD; TRIM63;