Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP88522_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

EIF5A Antibody - middle region (ARP88522_P050)

Catalog#: ARP88522_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EIF5A
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: PNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-EIF5A (ARP88522_P050) antibody is Catalog # AAP88522
Datasheets/ManualsPrintable datasheet for anti-EIF5A (ARP88522_P050) antibody
Gene SymbolEIF5A
Official Gene Full Nameeukaryotic translation initiation factor 5A
Alias SymbolsEIF-5A, EIF5A1, eIF5AI
NCBI Gene Id1984
Protein Nameeukaryotic translation initiation factor 5A-1
Description of TargetmRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts.
Swissprot IdP63241-2
Protein Accession #NP_001137232.1
Nucleotide Accession #NM_001143760.1
Protein Size (# AA)184
Molecular Weight20 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express EIF5A.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express EIF5A.
Write Your Own Review
You're reviewing:EIF5A Antibody - middle region (ARP88522_P050)
Your Rating
Aviva HIS tag Deal
Aviva Travel Grant
Aviva Live Chat
Aviva Validation Data