| Product Number |
ARP88522_P050 |
| Product Page |
www.avivasysbio.com/eif5a-antibody-middle-region-arp88522-p050.html |
| Name |
EIF5A Antibody - middle region (ARP88522_P050) |
| Protein Size (# AA) |
184 amino acids |
| Molecular Weight |
20 kDa |
| NCBI Gene Id |
1984 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
eukaryotic translation initiation factor 5A |
| Alias Symbols |
EIF-5A, EIF5A1, eIF-4D, eIF5AI |
| Peptide Sequence |
Synthetic peptide located within the following region: PNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EIF5A (ARP88522_P050) antibody |
| Blocking Peptide |
For anti-EIF5A (ARP88522_P050) antibody is Catalog # AAP88522 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EIF5A |
| Uniprot ID |
P63241-2 |
| Protein Name |
eukaryotic translation initiation factor 5A-1 |
| Protein Accession # |
NP_001137232.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001143760.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EIF5A |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human HT1080 Whole Cell
 | Host: Rabbit
Target Name: EIF5A
Sample Tissue: Human HT1080 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
