EED Antibody - N-terminal region : Biotin (ARP35697_P050-Biotin)

Catalog No: ARP35697_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: IF, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EED
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EED (ARP35697_P050-Biotin) antibody is Catalog # AAP35697 (Previous Catalog # AAPP06943)
• Sample Type Confirmation:

  EED is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

• Reference: Rakotobe,D., (er) Virol. J. 5, 32 (2008)

Target Info

• Gene Symbol: EED
• Gene Full Name: Embryonic ectoderm development
• Alias Symbols: HEED, COGIS, WAIT1
• NCBI Gene Id: 8726
• Protein Name: Polycomb protein EED
• Description of Target: EED is a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhance
• Uniprot ID: O75530
• Protein Accession #: NP_003788
• Nucleotide Accession #: NM_003797
• Protein Size (# AA): 441
• Molecular Weight: 50kDa
• Protein Interactions: PINK1; BRCA1; ADAM17; EZH2; IMP3; PSPC1; NAT10; PBRM1; RIF1; RBM28; HEATR1; MAGOHB; ARGLU1; MRPL20; NRDE2; CASZ1; BCOR; EXOSC4; LUC7L3; SF3B6; NOP58; SRRT; RAB14; C9orf114; CRNKL1; DDX47; HP1BP3; MYEF2; TRA2A; CPSF1; IGHV3-23; UTP20; PRPF19; ZNF638; RBMX;