Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP35697_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35697_P050-FITC Conjugated

ARP35697_P050-HRP Conjugated

ARP35697_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IF, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133537 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EED
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data Anti-EED (ARP35697_P050)
Peptide Sequence Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EED (ARP35697_P050) antibody is Catalog # AAP35697 (Previous Catalog # AAPP06943)
Datasheets/Manuals Printable datasheet for anti-EED (ARP35697_P050) antibody
Sample Type Confirmation

EED is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

Target Reference Rakotobe,D., (er) Virol. J. 5, 32 (2008)
Publications

Lin, PC; Huang, HD; Chang, CC; Chang, YS; Yen, JC; Lee, CC; Chang, WH; Liu, TC; Chang, JG; Long noncoding RNA TUG1 is downregulated in non-small cell lung cancer and can regulate CELF1 on binding to PRC2. 16, 583 (2016). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27485439

Gene Symbol EED
Official Gene Full Name Embryonic ectoderm development
Alias Symbols HEED, WAIT1
NCBI Gene Id 8726
Protein Name Polycomb protein EED
Description of Target EED is a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhance
Swissprot Id O75530
Protein Accession # NP_003788
Nucleotide Accession # NM_003797
Protein Size (# AA) 441
Molecular Weight 50kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EED.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EED.
Protein Interactions PINK1; BRCA1; ADAM17; EZH2; IMP3; PSPC1; NAT10; PBRM1; RIF1; RBM28; HEATR1; MAGOHB; ARGLU1; MRPL20; NRDE2; CASZ1; BCOR; EXOSC4; LUC7L3; SF3B6; NOP58; SRRT; RAB14; C9orf114; CRNKL1; DDX47; HP1BP3; MYEF2; TRA2A; CPSF1; IGHV3-23; UTP20; PRPF19; ZNF638; RBMX;
Write Your Own Review
You're reviewing:EED Antibody - N-terminal region (ARP35697_P050)
Your Rating