Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35697_P050-FITC Conjugated

ARP35697_P050-HRP Conjugated

ARP35697_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IF, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133537 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EED
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data Anti-EED (ARP35697_P050)
Peptide Sequence Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EED (ARP35697_P050) antibody is Catalog # AAP35697 (Previous Catalog # AAPP06943)
Datasheets/Manuals Printable datasheet for anti-EED (ARP35697_P050) antibody
Sample Type Confirmation

EED is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

Target Reference Rakotobe,D., (er) Virol. J. 5, 32 (2008)

Lin, PC; Huang, HD; Chang, CC; Chang, YS; Yen, JC; Lee, CC; Chang, WH; Liu, TC; Chang, JG; Long noncoding RNA TUG1 is downregulated in non-small cell lung cancer and can regulate CELF1 on binding to PRC2. 16, 583 (2016). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27485439

Gene Symbol EED
Official Gene Full Name Embryonic ectoderm development
Alias Symbols HEED, WAIT1
NCBI Gene Id 8726
Protein Name Polycomb protein EED
Description of Target EED is a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhance
Swissprot Id O75530
Protein Accession # NP_003788
Nucleotide Accession # NM_003797
Protein Size (# AA) 441
Molecular Weight 50kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EED.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EED.
Protein Interactions PINK1; BRCA1; ADAM17; EZH2; IMP3; PSPC1; NAT10; PBRM1; RIF1; RBM28; HEATR1; MAGOHB; ARGLU1; MRPL20; NRDE2; CASZ1; BCOR; EXOSC4; LUC7L3; SF3B6; NOP58; SRRT; RAB14; C9orf114; CRNKL1; DDX47; HP1BP3; MYEF2; TRA2A; CPSF1; IGHV3-23; UTP20; PRPF19; ZNF638; RBMX;
  1. What is the species homology for "EED Antibody - N-terminal region (ARP35697_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "EED Antibody - N-terminal region (ARP35697_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EED Antibody - N-terminal region (ARP35697_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "EED Antibody - N-terminal region (ARP35697_P050)"?

    This target may also be called "HEED, WAIT1" in publications.

  5. What is the shipping cost for "EED Antibody - N-terminal region (ARP35697_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EED Antibody - N-terminal region (ARP35697_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EED Antibody - N-terminal region (ARP35697_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EED Antibody - N-terminal region (ARP35697_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EED"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EED"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EED"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EED"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EED"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EED"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EED Antibody - N-terminal region (ARP35697_P050)
Your Rating
We found other products you might like!