EED Antibody - N-terminal region (ARP35697_P050)

Size:100 ul

Human OVCAR3

Human Fetal Heart

Human Fetal Lung

Human Fetal Liver

Human Fetal Muscle

Human Fetal Stomach

Human A549 Whole Cell

Rat Brain

Basic Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IF, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-133537 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EED
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%
• Complete computational species homology data: Anti-EED (ARP35697_P050)
• Peptide Sequence: Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-EED (ARP35697_P050) antibody is Catalog # AAP35697 (Previous Catalog # AAPP06943)
• Datasheets/Manuals: Printable datasheet for anti-EED (ARP35697_P050) antibody
• Sample Type Confirmation:

  EED is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

• Target Reference: Rakotobe,D., (er) Virol. J. 5, 32 (2008)
• Publications:

  Lin, PC; Huang, HD; Chang, CC; Chang, YS; Yen, JC; Lee, CC; Chang, WH; Liu, TC; Chang, JG; Long noncoding RNA TUG1 is downregulated in non-small cell lung cancer and can regulate CELF1 on binding to PRC2. 16, 583 (2016). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27485439

Target Info

• Gene Symbol: EED
• Official Gene Full Name: Embryonic ectoderm development
• Alias Symbols: HEED, WAIT1
• NCBI Gene Id: 8726
• Protein Name: Polycomb protein EED
• Description of Target: EED is a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhance
• Swissprot Id: O75530
• Protein Accession #: NP_003788
• Nucleotide Accession #: NM_003797
• Protein Size (# AA): 441
• Molecular Weight: 50kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express EED.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express EED.
• Protein Interactions: PINK1; BRCA1; ADAM17; EZH2; IMP3; PSPC1; NAT10; PBRM1; RIF1; RBM28; HEATR1; MAGOHB; ARGLU1; MRPL20; NRDE2; CASZ1; BCOR; EXOSC4; LUC7L3; SF3B6; NOP58; SRRT; RAB14; C9orf114; CRNKL1; DDX47; HP1BP3; MYEF2; TRA2A; CPSF1; IGHV3-23; UTP20; PRPF19; ZNF638; RBMX;