EED antibody - N-terminal region (ARP35697_P050)

Catalog#: ARP35697_P050

• Size: 100 ul

• Gene Symbol: EED
• NCBI Gene Id: 8726
• Official Gene Full Name: Embryonic ectoderm development
• Protein Name: Polycomb protein EED
• Swissprot Id: O75530
• Protein Accession #: NP_003788
• Nucleotide Accession #: NM_003797
• Alias Symbols: HEED, WAIT1
• Replacement Item: This antibody may replace item sc-133537 from Santa Cruz Biotechnology.
• Description of Target: EED is a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhance
• Protein Size (# AA): 441
• Molecular Weight: 50kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Affinity Purified
• Application: IF, WB
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express EED.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EED
• Tested Species Reactivity: Human, Rat
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: PINK1; BRCA1; ADAM17; EZH2; IMP3; PSPC1; NAT10; PBRM1; RIF1; RBM28; HEATR1; MAGOHB; ARGLU1; MRPL20; NRDE2; CASZ1; BCOR; EXOSC4; LUC7L3; SF3B6; NOP58; SRRT; RAB14; C9orf114; CRNKL1; DDX47; HP1BP3; MYEF2; TRA2A; CPSF1; IGHV3-23; UTP20; PRPF19; ZNF638; RBMX;
• Blocking Peptide: For anti-EED (ARP35697_P050) antibody is Catalog # AAP35697 (Previous Catalog # AAPP06943)
• Sample Type Confirmation:

  EED is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

• Target Reference: Rakotobe,D., (er) Virol. J. 5, 32 (2008)
• Publications:

  Lin, PC; Huang, HD; Chang, CC; Chang, YS; Yen, JC; Lee, CC; Chang, WH; Liu, TC; Chang, JG; Long noncoding RNA TUG1 is downregulated in non-small cell lung cancer and can regulate CELF1 on binding to PRC2. 16, 583 (2016). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27485439

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Customer Reviews for EED Antibody (ARP35697_P050) tested with rat brain in Immunofluorescence

Product Protocols: EED antibody tested with Human Ovcar-3 Cells (ARP35697_P050)