Size:100 ul
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46625_P050-FITC Conjugated

ARP46625_P050-HRP Conjugated

ARP46625_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Additional Information IHC Information: Placenta
IHC Information: Tonsil
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-12530 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DLL1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-DLL1 (ARP46625_P050)
Peptide Sequence Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DLL1 (ARP46625_P050) antibody is Catalog # AAP46625 (Previous Catalog # AAPP27428)
Datasheets/Manuals Printable datasheet for anti-DLL1 (ARP46625_P050) antibody
Target Reference Dezso,K., (2008) Virchows Arch. 452 (4), 443-448

Caliceti, C. et al. 17b-estradiol enhances signalling mediated by VEGF-A-delta-like ligand 4-notch1 axis in human endothelial cells. PLoS One 8, e71440 (2013). WB, IHC, Cow, Human, Mouse, Pig, Rabbit, Rat 23967210

Suprynowicz, F. A. et al. Conditionally reprogrammed cells represent a stem-like state of adult epithelial cells. Proc. Natl. Acad. Sci. U. S. A. 109, 20035-40 (2012). WB, IHC, Cow, Human, Mouse, Pig, Rabbit, Rat 23169653

Gene Symbol DLL1
Official Gene Full Name Delta-like 1 (Drosophila)
Alias Symbols DELTA1, Delta, DL1
NCBI Gene Id 28514
Protein Name Delta-like protein 1
Description of Target DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id O00548
Protein Accession # NP_005609
Nucleotide Accession # NM_005618
Protein Size (# AA) 723
Molecular Weight 78kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DLL1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DLL1.
Write Your Own Review
You're reviewing:DLL1 Antibody - N-terminal region (ARP46625_P050)
Your Rating