Search Antibody, Protein, and ELISA Kit Solutions

DLL1 Antibody - N-terminal region (ARP46625_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46625_P050-FITC Conjugated

ARP46625_P050-HRP Conjugated

ARP46625_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Rat
Predicted Species Reactivity:
Cow, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Placenta
IHC Information: Tonsil
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Delta-like 1 (Drosophila)
NCBI Gene Id:
Protein Name:
Delta-like protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DELTA1, Delta, DL1
Replacement Item:
This antibody may replace item sc-12530 from Santa Cruz Biotechnology.
Description of Target:
DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DLL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DLL1.
The immunogen is a synthetic peptide directed towards the N terminal region of human DLL1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-DLL1 (ARP46625_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DLL1 (ARP46625_P050) antibody is Catalog # AAP46625 (Previous Catalog # AAPP27428)
Printable datasheet for anti-DLL1 (ARP46625_P050) antibody
Target Reference:
Dezso,K., (2008) Virchows Arch. 452 (4), 443-448

Caliceti, C. et al. 17b-estradiol enhances signalling mediated by VEGF-A-delta-like ligand 4-notch1 axis in human endothelial cells. PLoS One 8, e71440 (2013). WB, IHC, Cow, Human, Mouse, Pig, Rabbit, Rat 23967210

Suprynowicz, F. A. et al. Conditionally reprogrammed cells represent a stem-like state of adult epithelial cells. Proc. Natl. Acad. Sci. U. S. A. 109, 20035-40 (2012). WB, IHC, Cow, Human, Mouse, Pig, Rabbit, Rat 23169653

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...