Search Antibody, Protein, and ELISA Kit Solutions

DLL1 antibody - N-terminal region (ARP46625_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46625_P050-FITC Conjugated

ARP46625_P050-HRP Conjugated

ARP46625_P050-Biotin Conjugated

Gene Symbol:
DLL1
NCBI Gene Id:
28514
Official Gene Full Name:
Delta-like 1 (Drosophila)
Protein Name:
Delta-like protein 1
Swissprot Id:
O00548
Protein Accession #:
NP_005609
Nucleotide Accession #:
NM_005618
Alias Symbols:
DELTA1, Delta, DL1
Replacement Item:
This antibody may replace item sc-12530 from Santa Cruz Biotechnology.
Description of Target:
DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
723
Molecular Weight:
78kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DLL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DLL1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DLL1
Tested Species Reactivity:
Human, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-DLL1 (ARP46625_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
EPN1; UBC; MIB1; MAGI2; CNKSR3; POFUT1; DLL1; MFNG; ADAM10; NOTCH3; NOTCH2; NOTCH1; NOV; PSEN1; MAGI1;
Blocking Peptide:
For anti-DLL1 (ARP46625_P050) antibody is Catalog # AAP46625 (Previous Catalog # AAPP27428)
Datasheets/Manuals:
Printable datasheet for anti-DLL1 (ARP46625_P050) antibody
Additional Information:
IHC Information: Placenta
IHC Information: Tonsil
Target Reference:
Dezso,K., (2008) Virchows Arch. 452 (4), 443-448
Publications:

Suprynowicz, F. A. et al. Conditionally reprogrammed cells represent a stem-like state of adult epithelial cells. Proc. Natl. Acad. Sci. U. S. A. 109, 20035-40 (2012). WB, IHC, Cow, Human, Mouse, Pig, Rabbit, Rat 23169653

Caliceti, C. et al. 17β-estradiol enhances signalling mediated by VEGF-A-delta-like ligand 4-notch1 axis in human endothelial cells. PLoS One 8, e71440 (2013). WB, IHC, Cow, Human, Mouse, Pig, Rabbit, Rat 23967210

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...