Size:100 ul
$319.00
In Stock
SKU
ARP46625_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46625_P050-FITC Conjugated

ARP46625_P050-HRP Conjugated

ARP46625_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Additional Information IHC Information: Placenta
IHC Information: Tonsil
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-12530 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DLL1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-DLL1 (ARP46625_P050)
Peptide Sequence Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DLL1 (ARP46625_P050) antibody is Catalog # AAP46625 (Previous Catalog # AAPP27428)
Datasheets/Manuals Printable datasheet for anti-DLL1 (ARP46625_P050) antibody
Target Reference Dezso,K., (2008) Virchows Arch. 452 (4), 443-448
Publications

Caliceti, C. et al. 17b-estradiol enhances signalling mediated by VEGF-A-delta-like ligand 4-notch1 axis in human endothelial cells. PLoS One 8, e71440 (2013). WB, IHC, Cow, Human, Mouse, Pig, Rabbit, Rat 23967210

Suprynowicz, F. A. et al. Conditionally reprogrammed cells represent a stem-like state of adult epithelial cells. Proc. Natl. Acad. Sci. U. S. A. 109, 20035-40 (2012). WB, IHC, Cow, Human, Mouse, Pig, Rabbit, Rat 23169653

Gene Symbol DLL1
Official Gene Full Name Delta-like 1 (Drosophila)
Alias Symbols DELTA1, Delta, DL1
NCBI Gene Id 28514
Protein Name Delta-like protein 1
Description of Target DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id O00548
Protein Accession # NP_005609
Nucleotide Accession # NM_005618
Protein Size (# AA) 723
Molecular Weight 78kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DLL1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DLL1.
Protein Interactions EPN1; UBC; MIB1; MAGI2; CNKSR3; POFUT1; DLL1; MFNG; ADAM10; NOTCH3; NOTCH2; NOTCH1; NOV; PSEN1; MAGI1;
  1. What is the species homology for "DLL1 Antibody - N-terminal region (ARP46625_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Cow, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "DLL1 Antibody - N-terminal region (ARP46625_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DLL1 Antibody - N-terminal region (ARP46625_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DLL1 Antibody - N-terminal region (ARP46625_P050)"?

    This target may also be called "DELTA1, Delta, DL1" in publications.

  5. What is the shipping cost for "DLL1 Antibody - N-terminal region (ARP46625_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DLL1 Antibody - N-terminal region (ARP46625_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DLL1 Antibody - N-terminal region (ARP46625_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "78kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DLL1 Antibody - N-terminal region (ARP46625_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DLL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DLL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DLL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DLL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DLL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DLL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DLL1 Antibody - N-terminal region (ARP46625_P050)
Your Rating
We found other products you might like!