DLL1 Antibody - N-terminal region (ARP46625_P050)

• Product Number: ARP46625_P050
• Name: DLL1 Antibody - N-terminal region (ARP46625_P050)
• Protein Size (# AA): 723 amino acids
• Molecular Weight: 78 kDa
• NCBI Gene Id: 28514
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Delta-like 1 (Drosophila)
• Alias Symbols: DL1, Delta, DELTA1, NEDBAS
• Peptide Sequence: Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Dezso,K., (2008) Virchows Arch. 452 (4), 443-448
• Description of Target: DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: EPN1; UBC; MIB1; MAGI2; CNKSR3; POFUT1; DLL1; MFNG; ADAM10; NOTCH3; NOTCH2; NOTCH1; NOV; PSEN1; MAGI1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Additional Information: IHC Information: Placenta
  IHC Information: Tonsil
• Blocking Peptide: For anti-DLL1 (ARP46625_P050) antibody is Catalog # AAP46625 (Previous Catalog # AAPP27428)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DLL1
• Uniprot ID: O00548
• Protein Name: Delta-like protein 1
• Publications:

  Caliceti, C. et al. 17beta-estradiol enhances signalling mediated by VEGF-A-delta-like ligand 4-notch1 axis in human endothelial cells. PLoS One 8, e71440 (2013). 23967210

  Suprynowicz, F. A. et al. Conditionally reprogrammed cells represent a stem-like state of adult epithelial cells. Proc. Natl. Acad. Sci. U. S. A. 109, 20035-40 (2012). 23169653

• Protein Accession #: NP_005609
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005618
• Tested Species Reactivity: Human, Rat
• Gene Symbol: DLL1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Pig, Rabbit
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Rat Brain
  
  Host: Rabbit
  Target Name: DLL1
  Sample Tissue: Rat Brain
  Antibody Dilution: 1ug/ml
• Image 2: Mouse spleen, Mouse intestine
  
  Host: Rabbit
  Target: DLL1
  Positive control (+): Mouse spleen (M-SP)
  Negative control (-): Mouse intestine (M-IN)
  Antibody concentration: 1ug/ml
• Image 3: Human Placenta
  
  Anti-DLL1 antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
• Image 4: Human Tonsil
  
  Anti-DLL1 antibody IHC of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
• Image 5: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.