DDIT3 Antibody - N-terminal region (ARP31591_P050)

Catalog No: ARP31591_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: DDIT3
Sample Type: Stomach Tumor lysates
Antibody Dilution: 1.0ug/ml

Rabbit Anti-DDIT3 Antibody
Catalog Number: ARP31591_P050
Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue
Observed Staining: Cytoplasm in intercalated disc
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DDIT3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 92%; Sheep: 86%
• Peptide Sequence: Synthetic peptide located within the following region: SLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DDIT3 (ARP31591_P050) antibody is Catalog # AAP31591

Target Info

• Gene Symbol: DDIT3
• Gene Full Name: DNA-damage-inducible transcript 3
• Alias Symbols: CHOP, CEBPZ, CHOP10, CHOP-10, GADD153, AltDDIT3, C/EBPzeta
• NCBI Gene Id: 1649
• Protein Name: DNA damage-inducible transcript 3 protein Ensembl ENSP00000447803 Ensembl ENSP00000448665
• Description of Target: This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.
• Uniprot ID: F8VS99
• Protein Accession #: NP_001181985
• Protein Size (# AA): 192
• Molecular Weight: 21kDa
• Protein Interactions: CCDC153; ATPAF2; ZC3H14; TRIB3; C11orf30; BATF3; VPS37C; AMOTL2; HSD17B14; SNAPC5; HDAC5; HDAC6; TNFSF12; ZBTB25; UBC; LMO2; HDAC1; FOSL2; EP300; CEBPG; C14orf80; GIPC1; BATF; ATF4; PPIB; MAFF; CREB3; FOSL1; NFIL3; MAFG; JUNB; JUN; FOS; EPAS1; DDIT3; DBP;