DDIT3 Antibody - N-terminal region : HRP (ARP31591_P050-HRP)

Catalog No: ARP31591_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB, IHC
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DDIT3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 92%; Sheep: 86%
• Peptide Sequence: Synthetic peptide located within the following region: SLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DDIT3 (ARP31591_P050-HRP) antibody is Catalog # AAP31591

Target Info

• Gene Symbol: DDIT3
• Gene Full Name: DNA-damage-inducible transcript 3
• Alias Symbols: CHOP, CEBPZ, CHOP10, CHOP-10, GADD153, AltDDIT3, C/EBPzeta
• NCBI Gene Id: 1649
• Protein Name: DNA damage-inducible transcript 3 protein Ensembl ENSP00000447803 Ensembl ENSP00000448665
• Description of Target: This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.
• Uniprot ID: F8VS99
• Protein Accession #: NP_001181985
• Protein Size (# AA): 192
• Molecular Weight: 21kDa
• Protein Interactions: CCDC153; ATPAF2; ZC3H14; TRIB3; C11orf30; BATF3; VPS37C; AMOTL2; HSD17B14; SNAPC5; HDAC5; HDAC6; TNFSF12; ZBTB25; UBC; LMO2; HDAC1; FOSL2; EP300; CEBPG; C14orf80; GIPC1; BATF; ATF4; PPIB; MAFF; CREB3; FOSL1; NFIL3; MAFG; JUNB; JUN; FOS; EPAS1; DDIT3; DBP;