Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP62790_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP62790_P050-FITC Conjugated

ARP62790_P050-HRP Conjugated

ARP62790_P050-Biotin Conjugated

DACT1 Antibody - N-terminal region (ARP62790_P050)

Catalog#: ARP62790_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-377030 from Santa Cruz Biotechnology.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology dataAnti-DACT1 (ARP62790_P050)
Peptide SequenceSynthetic peptide located within the following region: LRLDVEKTSEEHLETDSRPSSGFYELSDGASGSLSNSSNSVFSECLSSCH
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-DACT1 (ARP62790_P050) antibody is Catalog # AAP62790
Datasheets/ManualsPrintable datasheet for anti-DACT1 (ARP62790_P050) antibody
Gene SymbolDACT1
Official Gene Full NameDapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis)
Alias SymbolsDAPPER, DAPPER1, DPR1, FRODO, HDPR1, THYEX3
NCBI Gene Id51339
Protein NameDapper homolog 1
Description of TargetDACT1 positively regulates DVL2-mediated signaling pathways during development. It binds to DVL2 and impedes the degradation of CTNNB1/beta-catenin, thereby enhancing the transcriptional activation of target genes of the Wnt signaling pathway.
Swissprot IdQ9NYF0
Protein Accession #NP_057735
Nucleotide Accession #NM_016651
Protein Size (# AA)836
Molecular Weight92kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express DACT1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express DACT1.
Protein InteractionsBECN1; PIK3C3; ATG14; CBX6; PPP1CC; Dact1; Dact3; C7orf25; TK1; SH3GL2; CSNK2B; LEF1; HDAC1;
Write Your Own Review
You're reviewing:DACT1 Antibody - N-terminal region (ARP62790_P050)
Your Rating
Aviva Validation Data
Aviva ChIP Antibodies
Aviva Pathways
Assay Development