Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

DACT1 Antibody - N-terminal region (ARP62790_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP62790_P050-FITC Conjugated

ARP62790_P050-HRP Conjugated

ARP62790_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Dapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis)
NCBI Gene Id:
Protein Name:
Dapper homolog 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-377030 from Santa Cruz Biotechnology.
Description of Target:
DACT1 positively regulates DVL2-mediated signaling pathways during development. It binds to DVL2 and impedes the degradation of CTNNB1/beta-catenin, thereby enhancing the transcriptional activation of target genes of the Wnt signaling pathway.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DACT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DACT1.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-DACT1 (ARP62790_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LRLDVEKTSEEHLETDSRPSSGFYELSDGASGSLSNSSNSVFSECLSSCH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BECN1; PIK3C3; ATG14; CBX6; PPP1CC; Dact1; Dact3; C7orf25; TK1; SH3GL2; CSNK2B; LEF1; HDAC1;
Blocking Peptide:
For anti-DACT1 (ARP62790_P050) antibody is Catalog # AAP62790
Printable datasheet for anti-DACT1 (ARP62790_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...