DACT1 Antibody - N-terminal region (ARP62790_P050)

• Product Number: ARP62790_P050
• Name: DACT1 Antibody - N-terminal region (ARP62790_P050)
• Protein Size (# AA): 836 amino acids
• Molecular Weight: 92kDa
• NCBI Gene Id: 51339
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Dapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis)
• Alias Symbols: DPR1, TBS2, FRODO, HDPR1, DAPPER, THYEX3, DAPPER1
• Peptide Sequence: Synthetic peptide located within the following region: LRLDVEKTSEEHLETDSRPSSGFYELSDGASGSLSNSSNSVFSECLSSCH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: DACT1 positively regulates DVL2-mediated signaling pathways during development. It binds to DVL2 and impedes the degradation of CTNNB1/beta-catenin, thereby enhancing the transcriptional activation of target genes of the Wnt signaling pathway.
• Protein Interactions: BECN1; PIK3C3; ATG14; CBX6; PPP1CC; Dact1; Dact3; C7orf25; TK1; SH3GL2; CSNK2B; LEF1; HDAC1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DACT1 (ARP62790_P050) antibody is Catalog # AAP62790
• Uniprot ID: Q9NYF0
• Protein Name: Dapper homolog 1
• Protein Accession #: NP_057735
• Purification: Affinity Purified
• Nucleotide Accession #: NM_016651
• Tested Species Reactivity: Human
• Gene Symbol: DACT1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Image 1: Human MDA-MB-435S
  
  WB Suggested Anti-DACT1 Antibody
  Titration: 1.0 ug/ml
  Positive Control: MDA-MB-435S Whole Cell