Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CYP26A1 Antibody - N-terminal region : FITC (ARP60149_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP60149_P050 Unconjugated

ARP60149_P050-HRP Conjugated

ARP60149_P050-Biotin Conjugated

Gene Symbol:
CYP26A1
NCBI Gene Id:
1592
Swissprot Id:
O43174
Alias Symbols:
CYP26A1, CYP26, P450RAI1,
Replacement Item:
This antibody may replace item sc-53618 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein acts on retinoids, including all-trans-retinoic acid (RA), with both 4-hydroxylation and 18-hydroxylation activities. This enzyme regulates the cellular level of retinoic acid which is involved in regulation of gene expression in both embryonic and adult tissues. Two alternatively spliced transcript variants of this gene, which encode the distinct isoforms, have been reported.
Protein Size (# AA):
497
Molecular Weight:
54kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP26A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP26A1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CYP26A1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: HRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-CYP26A1 (ARP60149_P050-FITC) antibody is Catalog # AAP60149
Datasheets/Manuals:
Printable datasheet for anti-CYP26A1 (ARP60149_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...